KEGG   Baudoinia panamericana: BAUCODRAFT_34184Help
Entry
BAUCODRAFT_34184  CDS       T03106                                 

Definition
(RefSeq) glycoside hydrolase family 30 protein
  KO
K22276  glucan endo-1,6-beta-glucosidase [EC:3.2.1.75]
Organism
bcom  Baudoinia panamericana
Brite
Enzymes [BR:bcom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.75  glucan endo-1,6-beta-glucosidase
     BAUCODRAFT_34184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 19112354
NCBI-ProteinID: XP_007676179
JGI: Bauco1_34184
UniProt: M2NCY6
Position
Unknown
AA seq 597 aa AA seqDB search
MASLVQAVLFTFATHTFAQSISDLGVSGGNGSRGGIGDGDHPVMHAQAYITDAMIPLAPN
TTRQLAQGTAPVLSRTNNSGTCGNFRFVVVDSTSNGARQQMVGFGHAWTDSAVDVFNTLQ
PAVLDQVMNDLFGQSGNNMGFMRHTIGSSDLSGAQYSYDDNGPSFNEGEPDPSLANFSLG
QYGTAMAQMIAKMGTYKGDVFLFGAPWSLPGWMKNNDLFIAGITNTPGGQYPLLNNSFNI
GYIPQAVEYFTKYIDAFAQYGVTINGLSLENEPLNYQGGYPTMYLDAADEANILNQGLGS
MLQQRGVLAMAYDHNTDQPVYPYRVLQGAPSYAHAVAWHCYQGPYPNYTVMADISRAFPG
TLQFMTECSNYLPAAGSVNFEVAENFIPPVQQGASGAAMWVMATDPDFGPHSPYGGCNGC
LGSIVVNSSTTYTKTNDYYMIGQFSRFVRRGSVNYNVLRGNEGSGATSNQFYVMSVQNPD
GSWAVVFMNNMGSDQDVVLSFTGQGNQFWEGVVPSQTVTTWLIPSQQVLNQVNGTKAAST
VPPYPFTNTTSIPLTGSTTIAVCNITTATTSSSSSSTSTTALPVPDTTHTIATTSMV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcctggtccaggcagtgctctttacattcgctacgcacacattcgctcaatcc
atctcagatcttggtgtatctggtggaaatggcagccgaggaggcatcggagacggtgac
cacccagtcatgcatgcccaggcatacatcacggacgccatgatcccactggcacccaac
actaccagacagctagcccaagggacagcacctgtactctctcgcactaacaacagcgga
acatgtggcaatttccgcttcgtcgtcgtcgattccaccagcaacggcgcaaggcaacag
atggttggctttggtcacgcgtggactgatagcgcagtggatgtgtttaataccctgcag
cctgccgtccttgatcaggtcatgaacgacctctttggtcaaagcggcaacaacatgggc
tttatgagacacaccatcggctcaagtgatctcagtggcgcgcagtactcgtacgacgac
aacggacctagcttcaacgaaggcgagccggatccaagtctcgcgaacttctcactcggc
cagtatggaacagcaatggctcaaatgattgcaaagatgggcacctacaagggtgacgtc
ttccttttcggcgctccgtggtcgttaccaggctggatgaagaacaacgatctattcatc
gctggaatcaccaatacgcctggaggacaatatccgttgctcaacaactctttcaatatt
gggtacatcccacaagctgtggagtacttcacgaagtacatcgacgccttcgcacagtac
ggtgttaccatcaacggtctgtcgctcgagaacgagcccttgaactaccagggtggctat
cctaccatgtacctcgacgctgccgatgaggcgaacatcctcaaccaaggtctaggaagt
atgcttcaacagcgaggagtgctcgcaatggcatacgaccacaacaccgatcagcctgtc
tatccgtaccgggtcttgcaaggagcaccgagctacgcccatgccgttgcatggcattgc
tatcaagggccgtatcctaactataccgtgatggcagacatttctcgcgccttcccaggc
actctacaattcatgaccgagtgctccaattacctcccggccgctggctcggtcaacttt
gaagtcgctgagaacttcatcccaccggttcagcagggtgcatctggcgctgcaatgtgg
gttatggccaccgaccccgactttggtccgcattcaccttacggaggatgcaacggctgc
ctcggaagcattgttgtgaattccagcacgacatacacgaagaccaacgactattacatg
attggccagttctctcgcttcgttcgcagaggttcagtcaactacaacgttttgcggggc
aacgagggtagcggcgcgacgagcaaccagttctacgttatgtcagtccagaacccggac
gggtcatgggctgtggtcttcatgaacaacatgggcagcgaccaagacgttgtgctttca
ttcactggtcaaggcaaccagttttgggaaggcgtggtgccgagccaaacagtgactacc
tggctcatcccgtcgcagcaggtactgaaccaggtgaacggaaccaaggctgcaagcact
gtacctccgtacccattcaccaacaccacctccattccgttgaccggatcaacgactatt
gctgtgtgcaacatcaccaccgcaacaacatcgagcagcagtagctctacgagcaccacg
gcactaccagtaccggataccacgcatacgattgctacaacgagcatggtgtaa

DBGET integrated database retrieval system