KEGG   Baudoinia panamericana: BAUCODRAFT_372828Help
Entry
BAUCODRAFT_372828 CDS       T03106                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00052  Galactose metabolism
bcom00500  Starch and sucrose metabolism
bcom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BAUCODRAFT_372828
   00500 Starch and sucrose metabolism
    BAUCODRAFT_372828
Enzymes [BR:bcom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     BAUCODRAFT_372828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975 EPSP_synthase Glt_symporter
Motif
Other DBs
NCBI-GeneID: 19113206
NCBI-ProteinID: XP_007672811
JGI: Bauco1_372828
UniProt: M2NMA4
Position
Unknown
AA seq 704 aa AA seqDB search
MKSTTLLSSLLTALPLSFAQQQWGPPSYGHPSGPWPVSWLGSWGPDSASTAAATSTFRTS
TASAAASTSSAGSSGSSGSSGSSGNTQSCNAITTSQIESMGNNSLFTRWRPHYHFLAPAG
WMNDPNGPVYDPKTDTYHMFYQWHPEHINWGNISWGHATSKDQITWTDFNGWQDSQALAL
GPTGYGNYNGLGIFSGTAQAVNLHGQADGTLLIFYTSVAHLPTSWSIPYTPYTETQSLAY
STDGGNTWQEYAGNPVINTTTNLPPMNWNLTGFRDPFFEAWPALDAVIGVSEPHYYAVFG
SGIKGVGPRMPLWTAPASDLTQWTFLGALWEPADNTSLGPVLSTGSYGFNFEVSGFFSLP
DSEGELHYFVNMGTEGANVSFHQSAHWALWNEGVVSRRANGSVEFTPTAGGAGDWGLAYA
LLSFNDTKHNRRVQWGWAPEDLVGAGGLFSASQQGFQGSLTLQRELFVHETRNVINPNGT
LSTSKSASLRQNANGTFTAYTLGVRPLSDVVAGITANATHASYGTNTAYTSSKILQQQGD
THMALKATVSSATGACGLILAASPDMTEYTTISYQPSNSTILVDRSHSSSLTGFNNATVT
GYFAPYTYANGQQESITMTVFVDGSLLEVYVNDRFALATRIYPSMQCSTGFGVYVAPGAQ
ATFASVESWAGLLNVWPSRPLNSSSPLVWDSAAQTANYTWWSGN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcacgaccttgctttccagtcttctaacagcgctgccattgagctttgctcaa
cagcaatggggtccgccatcgtacggccatccttcgggcccatggccagtatcgtggctc
ggcagctggggaccggactctgcaagcacagcagctgccacaagtaccttccgtaccagc
actgcatctgccgcagcgtctacgtccagtgctggtagcagcggcagcagcggcagcagc
ggtagcagtggcaacacgcaaagctgcaatgcaatcactaccagccaaatcgagtcgatg
ggcaacaactcgctcttcacacgctggcggcctcattaccacttcctggcgcctgcggga
tggatgaacgatccgaatggacccgtctacgacccgaagacggacacgtaccacatgttc
tatcagtggcatccggagcatatcaattggggcaatatctcgtggggtcacgccacaagt
aaggatcaaattacatggacggactttaacggctggcaagactctcaagcactcgccctt
ggcccaacaggttatggcaactacaacggcctcggcatcttctccggcaccgctcaagcc
gtcaacctgcacggccaagcggacggcacccttctcatcttctacacctctgtcgcgcac
ctgcccacctcatggagtattccatacacgccatacaccgagacgcagtcgctcgcctac
agcacggacggcggaaacacctggcaggaatatgctggcaaccccgtcatcaacactact
accaacctaccgccaatgaactggaatctcaccggtttccgggacccgttcttcgaggct
tggcccgctcttgacgcggtgattggggtgagcgagccgcactactacgccgtcttcggg
tctggcatcaagggcgtaggacctcggatgccactctggactgcgccagccagcgatcta
acgcaatggaccttcttgggtgcgctgtgggagcctgccgacaatacatctctcggtccc
gtcctatctaccggcagctacggcttcaacttcgaagtctccggcttcttctccctaccg
gacagcgaaggcgagctccactacttcgtcaacatgggcacagaaggcgccaacgtctcc
ttccaccagagtgcacactgggcgctgtggaacgagggagtcgtctcccgacgtgcgaac
ggcagcgtggagttcacgcctactgccggtggagccggcgactggggtcttgcctacgct
ctactgagcttcaatgacacgaagcacaaccgtcgtgtgcaatggggctgggcaccggaa
gatctcgtgggagccggtggactcttcagtgcttcgcagcaagggttccagggctccttg
actctgcagcgcgagctcttcgtccacgaaacacgcaacgtgatcaatccgaacggtacg
ctctccaccagcaaatccgcctcgctgcgccagaacgccaacggtacctttacggcgtac
accctcggcgtacgtccattgtccgatgtcgtcgccggcatcaccgcgaacgccacacac
gcgtcctacggcaccaacaccgcatacaccagctccaaaatcctccaacagcaaggcgac
acgcacatggcgctcaaagccaccgtcagctccgccacaggcgcctgcggactaatcctc
gccgcttcgccagatatgacggaatacacaaccatctcctaccaaccctccaactccacc
atcctcgtcgaccgcagccacagcagctccctcaccggcttcaacaacgcgacggtaacc
ggctacttcgccccttacacctacgccaacgggcagcaagaaagcatcacgatgaccgtt
tttgtcgacggctcgctgctcgaagtctacgtcaacgaccggtttgcgctggcgacgagg
atttatccgagcatgcagtgttccacgggctttggcgtgtatgttgccccgggcgcgcaa
gccactttcgcgagtgtggagagttgggctgggctacttaatgtgtggccgtccagaccg
ctgaatagcagtagtccgcttgtgtgggattcggcggcgcagacggcgaattatacgtgg
tggagtgggaattag

DBGET integrated database retrieval system