KEGG   Baudoinia panamericana: BAUCODRAFT_491924Help
Entry
BAUCODRAFT_491924 CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00010  Glycolysis / Gluconeogenesis
bcom00071  Fatty acid degradation
bcom00350  Tyrosine metabolism
bcom01100  Metabolic pathways
bcom01110  Biosynthesis of secondary metabolites
bcom01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAUCODRAFT_491924
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAUCODRAFT_491924
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BAUCODRAFT_491924
Enzymes [BR:bcom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAUCODRAFT_491924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_2 Methyltransf_32
Motif
Other DBs
NCBI-GeneID: 19114865
NCBI-ProteinID: XP_007676714
JGI: Bauco1_491924
UniProt: M2MZ11
Position
Unknown
AA seq 362 aa AA seqDB search
MGSVGEGELPKKYKAVVYDEPGKVSTKVVELDMPEPGPGEVLINLTHSGVCHSDLGVMTN
RWAGLPHPTSPGQVGGHEGVGKIVKMGPGTESSAVKVGDRVGIKWISAICGSCPACLSGH
DGVCFNQKVSGYYTPGTFQQYVLGPASYVTPIPESLASDMAAPMLCAGVTVYSALRKSNA
QSGDWVVLMGAGGGLGHLATQIASRGMGMRVIGIDAGSKKDIAMDCGAEHFIDHTQGNAE
EEVKRITGGLGAQAVLVLTAANAAYGMAMTLLKFGGTLVCVGLPEGELKPIATAYPQMLV
AKAQKIVGVAVGDRREAIETLQLAERGVVKTHFRTAKMEDLTKIFEEMDEGKLKGRVVLD
LS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggttccgtaggagaaggagagctcccgaaaaagtacaaggccgtcgtctatgatgaa
cccggcaaggtgtccaccaaggtggtcgagcttgacatgccggagcctggacctggcgaa
gtcttgatcaacctcacacattccggggtctgccattcagatctcggagtcatgaccaac
cgctgggccggcctcccgcaccccaccagtcccggccaggtcggcggccatgaaggcgtc
ggcaagatcgtcaagatgggtcctggcactgagagctcggcggtcaaggtaggagaccga
gtcggcatcaaatggatctcggccatctgcggctcctgcccggcgtgtctgtccggccac
gatggggtttgcttcaaccagaaggtcagcggctactacacccctggcacgttccagcag
tatgtcctcgggcctgcgagctacgtgactcccatcccggagtcgctggcttcggatatg
gcggcgccgatgttgtgtgccggcgtgacggtctactccgccctacgcaagagcaacgca
cagtccggtgactgggtcgtactcatgggtgccggtggcggtcttggtcacctggccacc
caaatcgcctctcgcggcatgggcatgcgcgtcatcggcatcgacgccggcagcaagaag
gacatcgccatggactgcggcgcggagcacttcatcgaccacacccaaggcaacgcggaa
gaagaagtcaaacgcatcaccggcggactcggcgcacaagccgttctggtccttacagct
gctaacgccgcctacggcatggccatgactctactcaagttcggcgggacgctcgtctgt
gtcggtttgcctgagggcgagctgaaacccatcgccacggcttacccgcagatgttggtt
gcgaaagcgcagaagattgttggtgtggctgttggggacaggagggaggcgatcgagacg
ttgcagttggctgagagaggggtggtgaagacgcatttccgcacggcgaagatggaggat
ctgacgaagatctttgaggagatggatgagggaaagttgaagggacgggtggtgttggat
ttgagctaa

DBGET integrated database retrieval system