KEGG   Baudoinia panamericana: BAUCODRAFT_52192Help
Entry
BAUCODRAFT_52192  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
bcom  Baudoinia panamericana
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bcom03041]
    BAUCODRAFT_52192
   03110 Chaperones and folding catalysts [BR:bcom03110]
    BAUCODRAFT_52192
Enzymes [BR:bcom01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     BAUCODRAFT_52192
Spliceosome [BR:bcom03041]
 Complex C
  Other components
   PPlases
    BAUCODRAFT_52192
Chaperones and folding catalysts [BR:bcom03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    BAUCODRAFT_52192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase ORC_WH_C
Motif
Other DBs
NCBI-GeneID: 19115139
NCBI-ProteinID: XP_007675362
JGI: Bauco1_52192
UniProt: M2LSH0
Position
Unknown
AA seq 504 aa AA seqDB search
STLYNLEPQPTAKVILKTTSGDILLELFAKQTPLASRNFLQHCLDGYYDNTIFHRLVPGF
IIQGGDPTGTGSGGISALNDGAGFGDEFHSRLKFNRRGLLGMAKDVGGAGGGSDAYGSQF
FLTLDKTPELQGVCTMFGRVEGETIFNLVKMAVSELVEGSERPLYPTKVTGTEVLINPFQ
DMVARVKQAPRVREEAAGGKVEGKKRKKPVGKNVLSFGGQEGEDGLEAPVVKRVKANPKM
VSVGQETPEKMNNTKLPAAPDRESNQRRRDEEVPFMPGVDEEAQAKASSRKAPPERLMDD
DDEDENEDVEEQPNTKTLDRTNAEIAALKVSMKRTVNAAPKEKERPKNAFEAMIPSTSTR
GRKRGKLADEKGAIDLFKAFKQRLEELPPDEATSKATNGTHGSAREGTATNGHSAAPTTT
TESMDEEAELCDLHFIANCQSCKSWETEKPDGEAEEDGDDDPGWMSHALSFAKDTLGKDL
EWKRKMEEIEVIDPLERARGFKEE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
tcaaccctttacaacctcgaaccacaaccgacggccaaggtcatactcaagacgacatct
ggcgacatcctcctcgaactattcgccaagcagacacccttagcaagccggaacttcctt
caacactgcctcgatggctactatgacaacaccatcttccaccgcttggtgccggggttc
atcatccaaggcggggatcccactggaacaggctcgggcgggatctccgcgctcaacgat
ggcgcaggcttcggagatgagttccacagcagactcaagttcaaccggagaggattgttg
ggtatggcgaaagatgtaggtggtgctggaggtggtagcgatgcctacggtagccagttc
ttcttgactttggacaagacgccggagttgcagggtgtatgtacgatgtttgggcgcgtg
gaaggcgagacgattttcaacttggtcaagatggcggtttcggagctggtggaaggctct
gagcggcctttgtacccgaccaaggtcactggtacggaagttctgattaacccattccaa
gacatggttgcaagagtaaagcaggcgccgagggtcagggaggaagcggccggcggaaag
gtggaaggcaagaagaggaagaagccggtagggaagaatgtgttgagcttcggcggacag
gaaggtgaggatggattggaggctccggtcgtgaagcgagtcaaggcgaacccgaagatg
gtgtcggtcggacaggaaacgccagagaagatgaacaataccaagcttcctgccgcgccc
gatcgcgaaagtaaccagcgaagacgggatgaagaggtaccattcatgccgggggtagac
gaagaggcccaggcgaaagcgtcatcgaggaaggcaccaccggagcgtctcatggacgat
gacgatgaggatgagaatgaggatgtcgaagagcagcccaacaccaaaacgctcgatcgg
accaacgcagaaatagcagctttgaaggtaagcatgaagcgcacagtcaacgccgcaccg
aaggagaaagagcgaccgaagaacgcgttcgaagcgatgataccgtccacgagcacgcgt
gggcgcaaacgtggcaagctggcagacgagaagggtgcaatagatctgttcaaagcgttc
aagcagcgccttgaagaactccctccggatgaggccacatcaaaagccacaaacggcacg
cacggttcagcgagagaggggacagcaacgaatggccactcggctgcaccaaccaccacc
acggaatctatggacgaggaagcagagttgtgcgatctgcacttcatcgccaactgtcag
tcttgcaagtcgtgggagacggagaagccggatggtgaagcggaggaggatggagatgac
gaccctggttggatgagccatgccctgtccttcgccaaggacacgttaggtaaggacctg
gaatggaagaggaagatggaggagatcgaggtcattgacccgctcgagcgtgcgagaggc
ttcaaggaggag

DBGET integrated database retrieval system