KEGG   Baudoinia panamericana: BAUCODRAFT_62024
Entry
BAUCODRAFT_62024  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K15316  noranthrone synthase [EC:2.3.1.221]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00254  Aflatoxin biosynthesis
bcom01100  Metabolic pathways
bcom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    BAUCODRAFT_62024
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bcom01008]
    BAUCODRAFT_62024
Enzymes [BR:bcom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.221  noranthrone synthase
     BAUCODRAFT_62024
Polyketide biosynthesis proteins [BR:bcom01008]
 Polyketide synthase (PKS)
  Iterative type I PKS
   Fungal nonreducing PKS (NR-PKS)
    BAUCODRAFT_62024
SSDB
Motif
Pfam: ketoacyl-synt SAT Acyl_transf_1 Ketoacyl-synt_C Thioesterase PP-binding KAsynt_C_assoc PS-DH Thiolase_N Lipase_3
Other DBs
NCBI-GeneID: 19115961
NCBI-ProteinID: XP_007671613
JGI: Bauco1_62024
UniProt: M2N8F6
Position
Unknown
AA seq 2242 aa
MSPSAHVFLFGDQTYDFVPDLRKLLAIKTKPVLNAFFEQAHYVIRAQAQQWLGPVKAEKA
RSASLADLLQKYTEGHLSPAFQVALHSLTQLGAVIRHVLFYDEPGRLYPTQGSTYLVGLC
TGALAAAAIASSGSLSELLPAAVHTVQLALRLGLHAIDVRDRIYSSVSSEQEPWSVLYFG
VDEPAAAAALEKFSREKALTISGPPSTLKLLRKDVFFGNCKSKPIPIYLPAHVSHLYSME
DVRIIMSSTNLSQFQDFNVKLPVISGATGVFAWGGGLTALLEKALCECLLEPIRWDKVVA
NFSSLVSSSGTSTIVISPIATNLEQNMSAALKEIANVSVERLEALHEHPLQQLPQSRAKL
AIVGMSGRFPEAPSPADFWDLLYQGLDVCKEVPVQRWNWKTHVTADGKGHNLAGCKWGCW
LDYADQFDPRFFSISPKEAPQIDPAQRMALMTTYEALEQSGFVADKTASSQRTRVGVFHG
ITSNDYLECNSGQFIDTYFITGGNRAFVPGRINFCFEFCGPSYSNDTACSSSLAAIHLAC
NSLWRGDCDTAVAGGTNMCINPDGHTGLDKGFFLSRTGNCKPFDDKADGYCRGEAVATVI
IKRLDDAIAENDPILGVILDTKTNHSSLSDSMTRPHVGAQADNMKSVLASATVNASDVSY
VEMHGTGTQVGDAVEMESVLKVFAPDEQQRTPENPLYVGTVKANIGHGEGVSGITSLTKV
LLMLKNNMIPPHCGIKPGSKINRTYPDLGARNVHIAFKPTPWERRGGPRRALINNFSAAG
GNTALLLEEAPPREVASEDDPRTSHVLTVSGHVAASLKNNAKLLLQYLQQHTGTLELAQL
SYTLTARRQHHIHRISITGATVQEISDRLSAAIERGDGSNRPKSKPKMLFAFTGQGAMWV
AVGKQLHDAFPSFRSSLYAYDRMAQALGLSSFLPLLVDCNADVESSPAVTVQLATTALQM
ALADLLRSFGMSPVAVTGHSLGMYAALYTSGVLTASDAIYLVGKRAELFQQSCARGTHAM
LAIKASESTVNSQLTGQQFEIACANGPQDTVISGKSDCIAKAQAALTSNGIKSTMLKVPY
AFHSAQVDPILKPFSIIASGVTFRKPTITVLDPLTGAVVDKEGVFSATYLQRHCRETVDM
VSALQAGLKSGIVDVKSCISIEIGPHPVVCGMIRNTLGADLRSMAVLERSRDVWPNLTNL
LGSLYGSGAELDWTVYHQAFKSAHKVLELPAYAWDLKSYWIAYENDWCIHKPFALQNVSN
TDNKKAAALPPPAHEPVKVEAPSKETALKLPPAPPAPLTSTVHSLSEETIEADSIRIVVE
GDLGREDLRELARGHVVNDVPFTTPSWFADIAYTVGTYTVARLCPNRDVIVNVGDLAGDK
VLVPTGRAGQNLRLTFTASFERGQPQTITQGKFVFNAVDAKGRSTTRYGFGVIRFADRTL
YRQVTTKLPDYLNSIKRLRFGAEQGELCQYNKRSGYRLMSKIAGFGADYKLLDDVVVDES
SIEATCFVNFATIATKGNFAAHPGGVDAFTQLAGFCVNARECVDLDNECFISHGWNGLEL
YAPLTYDCKYELYVRMSADGTDWFKGDTAVLHDGKLVAFFKEVIVHRMPRKFRSAVTDAF
ATGSKGKAPVANAAKPAANKPAVRPETHYPGHLPTESGAPKHAAGKIAPSSVSETSQPVA
VAAAANAQAAETVARQGTAPKTPSQPKIPKASGLSAKTSKSIDDVLNIVSEESGVAKEEL
TDDSNFADMGVDSLCSMVIGSRLREELLLELGAEFSIFVDCPTVRSLKAFLIELNGEQMD
EAEAANAEEPGLVEPAVPEHVEENSVRFTEPPVAESVPLAKTAAHTQDSIIHHATPDAPA
SNITVTANVGPARALESKNALQVSTSAPVVNEALDIVAQESGIAKEDLSDDSVFADIGVD
SLCSMVIQSRLREELAIDLDPDFSIFVNCPTVADLKAFLSEGAPGVSGDSSDSAEDSGAS
TVITPPEEGPTPDWSASDECRSTTSVILQGIPKLANKTLFLMPDGSGSATSYITIPKLGD
DIAVVGLNCPYIRDPEELKCTPTAMVRSFCNEIKRRQPTGPYHVGGWSAGGGFAFACAYM
LTSEGHAVDSLIIIDSPIPSKLGTLPAEFYEYCGKLGLFGTGHPPTYLIPHFLRVMEAML
PYQARPVRAPKMPTVGLVWATETVMDGPNPPVVAKSHFMLQKRQNFGPDGWETLLPGADF
IIEKVEGANHFTMMVSQAAQVF
NT seq 6729 nt   +upstreamnt  +downstreamnt
atgagcccgtcagcacatgtctttctctttggagatcagacgtacgacttcgtacctgat
ctccgtaaactccttgccatcaagacgaagccggtgctcaacgcgttcttcgaacaagct
cactatgtaatcagagcacaggcacaacagtggctgggaccggtgaaggcagagaaggca
cgcagcgcgagcctcgcagacttgctgcagaaatacacagagggacatctgagcccggcg
ttccaggtggctttgcattcgctcacccaactaggcgcagtcatcaggcacgtgctcttt
tatgatgagcccggacgtctctacccaacccagggctctacctatctcgttgggctttgc
acaggtgccctcgctgcagctgccattgcatcctccggttccctctccgagctgcttcca
gcggcggtgcatactgtgcaattggcacttcgcctcggcttgcatgctattgacgtgcgt
gatcgtatctattcgagcgtttctagcgagcaggaaccatggtccgttctgtacttcgga
gtcgacgagccagccgctgccgccgctctcgagaagttctcacgggagaaggccttgacg
atcagcggtccgccgtcaacgctgaagcttctgcggaaggatgtgtttttcggcaattgc
aagtcgaagcctatcccgatatatttgcctgctcatgtctcacacctctattccatggag
gatgtacgcatcatcatgtcgtctactaacctgtcgcaattccaagatttcaacgtcaaa
ttgccagtcatctctggcgcaacaggagtctttgcatggggcggaggccttactgcattg
ctggagaaggcactgtgcgaatgtctgctggagcccatccggtgggacaaggtagtggcc
aacttctcgtcgctggtaagctcaagcggaacctctaccatagtcatatcgccaatcgcc
acaaacctggagcagaacatgtctgccgctcttaaagagatagcaaatgtctcggttgag
agattggaagctttgcatgagcatccgctgcagcaactgcctcagagccgtgcgaaactt
gccattgtcggcatgtccggtaggttcccggaagcacctagtcctgcagatttctgggac
ttgttatatcaaggactcgacgtttgcaaagaggtgccagtccagcggtggaattggaag
acacacgtgactgccgacggaaagggacacaatctcgctggctgcaaatggggctgttgg
cttgactatgctgaccagtttgatccacgtttcttcagcatatcacccaaggaggcgccg
caaattgatcctgctcagcgcatggcgcttatgacgacctacgaggctttagagcaatcc
ggtttcgtagccgacaagactgcgtcgtcccagcgcacccgtgttggagtattccacggc
attacttcgaatgactacttggaatgcaacagcggtcaattcatcgatacatacttcatc
accgggggcaatcgagctttcgtgcctggccgtattaacttttgcttcgagttctgtggg
cccagctacagcaacgacactgcttgctcctcgagcttggctgccatccatctggcgtgc
aattccctctggcgaggtgactgcgacacagccgttgcaggcggcacgaacatgtgtatc
aatcccgatggccatacagggctcgacaagggcttcttcctgagccgcactggcaactgc
aagcctttcgacgacaaagctgacggctactgtcgcggtgaagccgtggcgacggtgatc
ataaagcgtctggacgacgctattgcagagaacgaccctatccttggggttatcctcgat
acaaagaccaaccatagctccctttcagactcgatgacacgccctcatgttggagcacaa
gcggacaacatgaagtccgttcttgcgagtgctaccgtcaatgcctcggacgtcagctac
gttgagatgcacggaaccggcacgcaggtaggagacgctgttgaaatggagtccgtgttg
aaagtcttcgcaccagacgagcaacaacgcacgccggagaacccgctatatgttggcaca
gtgaaagccaacattggccacggcgaaggtgtttctggtatcacgagcttgacgaaagtt
ctccttatgctgaagaacaacatgattccgccgcattgtggtatcaaacctggcagcaag
atcaaccggacctaccccgatttgggggcccgcaatgtccatatcgccttcaagccaaca
ccatgggagcgtcgaggaggtccgagacgagcgctcattaacaatttcagtgccgccggc
ggcaacacggctctgctgctcgaggaggcgccacctagagaggtcgcatctgaagacgac
cctcggacgtcccacgtacttaccgtctcgggccacgttgctgcatctctcaaaaacaat
gctaagctgcttctgcaatacctacagcagcacacgggcacattggagttggctcaactc
tcgtatacgctcactgcgcgccgccagcaccacattcaccgcataagcattaccggggcc
acagtgcaagagatctcggatcgcctgagcgctgcgattgagcgcggcgatggaagcaac
cggccgaagtcgaagccaaagatgctgttcgcttttaccggacaaggtgcaatgtgggtt
gcagtaggcaaacagctgcatgacgccttcccgtccttccgcagtagtctatacgcctac
gaccgaatggcacaggctctgggcctgtcttcgttcttacccttgttggttgattgcaat
gcagatgtcgaaagcagcccggccgtcacagttcagctcgcaaccactgcgcttcagatg
gcgctggccgatctgctaagatcattcggcatgtcgccggttgctgtcaccggacacagc
cttggcatgtatgccgcgctgtacacctctggcgtattgacagcatcggacgcgatctac
cttgtgggtaaacgagctgagctattccagcagtcttgcgctcgtggtacccatgccatg
ctcgccatcaaagcctccgagagcaccgtcaatagccagttgaccggtcagcagttcgag
atagcctgcgccaacggaccacaagacacggtcatcagcgggaagagcgactgcattgcc
aaggctcaggcagccttgacgagcaacggaataaagagcacaatgttgaaggttccgtac
gccttccactcggctcaagtggatccaattctgaagcctttcagcatcattgcaagcggt
gtgaccttccgtaagccgaccatcaccgtcttagacccgctcactggtgccgtggtcgac
aaagagggcgtgttcagtgcgacttacttgcaaaggcactgtcgagagaccgtcgacatg
gtatccgcgctgcaagccggcctgaagagcggtatcgtggacgtgaagtcgtgcataagc
attgagattgggccgcacccggtggtctgcggcatgattcgcaacacgctcggcgccgac
ctcagatcgatggctgtgcttgagcgcagcagagacgtctggcccaacctgaccaacctg
ctcggcagcttgtatggctctggcgctgagctggactggaccgtctatcaccaggctttc
aagtcggcgcacaaggtgcttgagctgcccgcttacgcttgggatctaaagagctactgg
atcgcctacgagaatgattggtgcatacacaagccgttcgctttgcagaacgtgagcaac
acggataacaagaaggctgccgcgttgcctccgcctgcacatgagccggtcaaagttgaa
gcaccttccaaggagacagctctcaagctgcctccggccccgcctgcacctctgaccagt
actgtgcacagccttagtgaagagacgatcgaagccgactctattcgcattgtggtggag
ggagatttgggacgcgaagatttacgtgagctcgcccgtggtcatgtggtcaacgatgta
ccattcacgactcccagctggttcgcggatattgcgtacactgttggcacgtataccgtt
gccagactatgtccgaaccgcgatgtcatcgtcaatgtcggtgatttggctggagacaaa
gtcctcgtaccgactggccgcgcaggacagaacctgcgcttgaccttcactgcgtccttc
gaacgaggtcagccgcagacaattactcaaggcaaattcgtgttcaacgcagtcgatgcc
aaaggcagaagcaccacacggtacgggttcggagtcatccgttttgcggaccgcacactg
taccgacaggtaactacgaagttgccagattatctgaacagcatcaagcgcctgcgcttt
ggtgcagaacagggcgagctgtgccagtacaacaagcgtagcgggtatcgtttgatgtcc
aagattgccggatttggcgccgattacaagctgctggatgacgtggtggtcgacgaatcc
agcatcgaagcgacctgcttcgtcaacttcgctacgattgcgaccaagggcaacttcgcc
gctcacccaggcggtgtcgacgcgttcactcagttggccggcttttgcgtaaacgctcgc
gagtgtgtcgaccttgacaacgaatgcttcatcagtcacggctggaatggccttgaactc
tacgctcccttgacctatgactgcaagtatgagctttacgttcgcatgtccgctgacggt
accgactggttcaagggcgacacagcggtcttgcacgacggtaagctcgtggctttcttc
aaggaggtcatcgtgcaccgcatgcctcgcaagttccgcagtgcagtcaccgacgcgttt
gcgacaggctccaagggcaaggctccagttgccaacgcagcgaaaccagcagcgaacaag
ccagcggtacgtccggagacccattatccaggccacttacccaccgagtcgggtgcgccc
aagcacgctgccggtaaaattgcgccttcgtctgtcagcgaaactagtcaaccagttgct
gtcgcagcagcggcgaatgctcaagctgctgaaaccgtggccaggcaggggacagcacca
aagacgccatcacaacccaagatcccgaaagcctctggtctctccgccaagacttcgaag
tcgatcgatgatgttctgaacattgtctcggaggagagcggcgtagcgaaagaagagctc
accgacgatagcaacttcgcggacatgggcgtggactccttgtgctccatggtcattggc
agccgactgcgggaagagctgctcctggagctcggtgcagaattttcgattttcgtcgat
tgcccgactgtgaggtcgctcaaggcgttcctcatcgaactcaacggggagcagatggac
gaagccgaagcagccaatgcagaagaacccggcttggtcgagccggcagtcccggagcac
gtggaagagaactccgtgaggtttaccgagcctccagtagctgaatcggtcccactcgca
aaaactgcagcgcacacccaagacagtattatccaccatgctacgcccgacgcaccggct
tccaatattaccgtcactgccaacgttggcccggctagagccttggagtcgaagaacgcg
ctgcaggtttctacatctgcgccagtcgttaatgaggccttagacatcgttgcgcaggaa
agcggtatcgccaaagaggatctttctgacgacagcgtgttcgccgacatcggtgtcgac
tctctctgctctatggttattcagagtcgccttcgtgaagagcttgccatcgacctcgat
cccgacttctcgatctttgtcaactgcccaaccgtggctgacctcaaggcctttctgagc
gaaggcgcaccaggagttagcggagactcatctgacagcgccgaagactctggtgcttcc
acggtcattacgccgccggaggagggtcccacgccggattggtcggcttcagatgagtgt
cggtcgacaacctcagtcattcttcagggcatcccaaagcttgccaataagacgttgttc
ctcatgcccgatggcagcggctctgcaacgtcttacattacgattccaaagctcggcgac
gatattgcggtcgttggcctgaactgcccctacattcgtgaccccgaagagctcaagtgt
acccccacggccatggtccgcagcttctgcaacgagatcaagcgccgccaacccactggt
ccctatcatgtcggcggttggagcgccggcggtggctttgcctttgcctgcgcgtacatg
ctcacttccgagggtcacgccgtcgacagcttgatcattatcgactcgcctattccctcc
aagcttggtacgctgcccgccgagttctacgagtactgtggtaagcttggcctctttggc
accggccatccaccaacttacctcatcccgcatttcctgcgcgtgatggaggccatgctt
ccataccaggcacgaccggtgcgagcgccaaagatgccgactgtgggcctggtctgggct
acagagaccgtgatggatggtccaaaccctcctgtcgtggccaagtctcacttcatgctg
cagaagagacagaactttggtccagacggatgggagacattgttgccgggagcggatttc
atcattgagaaggtggaaggtgccaaccactttacgatgatggtgagtcaagcggcgcaa
gtattctag

DBGET integrated database retrieval system