KEGG   Baudoinia panamericana: BAUCODRAFT_64138Help
Entry
BAUCODRAFT_64138  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K20003  palmitoyltransferase ZDHHC4 [EC:2.3.1.225]
Organism
bcom  Baudoinia panamericana
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bcom04131]
    BAUCODRAFT_64138
Enzymes [BR:bcom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     BAUCODRAFT_64138
Membrane trafficking [BR:bcom04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    BAUCODRAFT_64138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 19116136
NCBI-ProteinID: XP_007673137
JGI: Bauco1_64138
UniProt: M2N5Z1
Position
Unknown
AA seq 393 aa AA seqDB search
MGALKNIVIAIFVLSLLTFVALFGQLPALRKTPIGWLQQALFVHIPNALKRVDQKVTGGR
IIVKSKRLGHYLFYERNPIVLIIFLILLTGSSGLFLWHAIHLLPTSLLLPIPLLLGLPYY
FTYLCATHTSHYITTLNLNYRLQGYPFDHILYHPGPQCRTCALPKPARSKHCSLCGHCVA
KCDHHCPWVNNCLGRGNYRYFLALLLSLGLLQLYGAYLSYYLLYPYFLAHRNRNVLFKRG
YWSELGEAMAYAIHRGGLPIAGVGLLAASTAAMPLALLGYHCYLIWAGMTTNESQKWADW
RDDMGEGCVFKASRKALKAHNRARRGSEDDEDGDAVGAVRWPVESDQVVVRTNDGEPPVG
QEGLWTRVWSLGDVENVYDLGGWDNLVEVLRGR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccctcaagaacatcgtaatcgccatcttcgtcctctcgctgctcaccttcgtt
gcgctcttcggccagcttccagcgctgaggaagaccccaattggctggctgcaacaagca
ctcttcgtccacatccctaatgctctcaagcgcgtcgatcagaaagtgactggcggacgc
atcatcgtcaagagtaaacgactcggtcactacctcttctacgagcggaacccgatcgtg
ctgatcatcttcctcattctcttaacgggcagctccggcctcttcctctggcacgccatc
caccttctgccaacgagccttcttctccccatcccgcttctgctcggtctgccatactac
ttcacctacctttgcgcaacccatacttcccactacattaccacgctgaacctcaactac
cgcctccagggttacccttttgatcatatcctctaccatcccggcccgcaatgtcggact
tgtgccttgcccaaaccggcccgaagcaaacactgctccctctgcggccactgcgtggca
aaatgcgaccaccactgtccctgggtgaacaactgtctgggacgaggcaactaccggtat
ttcctcgctttgctccttagcctgggcctactacaactttacggcgcgtatctgagctac
tacctcctctacccttacttcctcgcccatcggaaccggaacgttctgttcaaacgcggc
tactggagcgagctaggtgaagcaatggcttacgccatccaccgcggcgggctaccaatt
gcgggagtgggtttactagccgcttctactgctgccatgccgctggcgctgctggggtat
cattgctatcttatctgggccgggatgacgacgaatgagtcccagaagtgggcggattgg
cgggatgatatgggggagggttgtgtgtttaaagcctcacgaaaggctttgaaggcgcac
aatcgcgctcgcagaggttcggaggatgatgaggatggcgacgcggtaggcgcggtgcgc
tggccggtggagagtgatcaggttgtcgtaaggacgaacgatggcgagcccccagttggt
caggaggggctgtggacgagggtgtggagtttgggggacgtggagaatgtttatgatctc
gggggttgggataatctggttgaggttttgcgcggtcggtga

DBGET integrated database retrieval system