KEGG   Baudoinia panamericana: BAUCODRAFT_73250Help
Entry
BAUCODRAFT_73250  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bcom  Baudoinia panamericana
Brite
Enzymes [BR:bcom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     BAUCODRAFT_73250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2
Motif
Other DBs
NCBI-GeneID: 19116800
NCBI-ProteinID: XP_007678160
JGI: Bauco1_73250
UniProt: M2MS79
Position
Unknown
AA seq 313 aa AA seqDB search
MQAVTSLFTGSSGPQYLTGNKADIDAFIDKFDVFLFDCDGVLWSGDHLFPNVPETIQMLR
DKGKQLVFVTNNSTKSRADYKKKFDSMGISANEEEVFGSSYSAAVYISRILKLEPPKNKV
FVLGESGVEQELESEKVPYCGGTDPLLRREMMPEDYKHVADGSLLDDDVAIVLTGLDYHP
SYLKYALGMAYLRRGAKFLATNIDSTLPSAGTLFPGAGAISAPLLRASAQEPLALGKPSQ
AMMDAIEGKFQFDRKQACMIGDRLNTDIQFGIEGGLGGTLCVLTGVSKKEEFLAKGAKVV
PSAYVDALGDLLG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgttaccagtctcttcactggctcatccggcccacagtaccttactggcaac
aaggcggacattgatgcctttatagacaagttcgacgtcttcctctttgattgcgatggc
gtactctggtcaggcgatcacctcttccccaatgtccccgaaacaatccaaatgctgcgc
gacaagggtaaacaactcgtctttgtcaccaacaacagcaccaagagtcgggcagactac
aagaagaagtttgacagcatgggcatctccgccaacgaagaggaggtgtttgggtcgagc
tacagcgccgcagtatatatttcgcggatccttaagctcgagccgccgaagaataaagtc
tttgtcttgggtgagagcggcgtggagcaggagttggagagcgagaaagttccgtattgc
ggtggcacggatccgttgttgaggagggagatgatgccggaggactacaagcacgttgcg
gacggatcgttactggacgacgatgttgcgatcgtattgacaggactcgattaccatccc
agctacctcaagtatgcgctcgggatggcctatctccgccgaggcgccaagttcctcgct
accaacatcgactccacgctgccttcggccggcacgctgtttccgggtgctggagcgatc
agtgcgccgctgcttcgagcttccgctcaggaaccactggcgctgggaaagccgagccag
gcgatgatggatgcgattgagggcaagttccagttcgatcggaagcaggcgtgcatgatt
ggtgatcggctgaatactgacattcagttcggtattgagggtggattgggtgggacactg
tgtgtgcttactggtgttagcaagaaggaagagttcttagccaagggtgcaaaggtggtg
ccgagtgcgtatgtggatgcgctaggagatctgttgggctag

DBGET integrated database retrieval system