KEGG   Baudoinia panamericana: BAUCODRAFT_75705Help
Entry
BAUCODRAFT_75705  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00680  Methane metabolism
bcom01100  Metabolic pathways
bcom01200  Carbon metabolism
Module
bcom_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BAUCODRAFT_75705
Enzymes [BR:bcom01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     BAUCODRAFT_75705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh DXP_synthase_N
Motif
Other DBs
NCBI-GeneID: 19116976
NCBI-ProteinID: XP_007679357
JGI: Bauco1_75705
UniProt: M2MAL8
Position
Unknown
AA seq 715 aa AA seqDB search
MEPNDRTQYVVRCYRALIADLCQQFNMGHPGSAMGMAAIGVALWKYVMKYSPKNADFFNR
DRFVLSNGHACLFQYTFLHLTGYQAMTFEQLSSYHSERWDSYTPGHPEIEHEGIEVTTGP
LGQGIANAVGLAMATKHLGAVYNRPGFEMVNNMTWVTIGDACLQEGVGMEAIQLAGHWRL
DNLCVIYDNNQITCDGSVDICMAEDVNMKMRASGFEVLEVEDGNHDVESIVKALVAARAN
KKRPTFINIKTTIGVGSKKQGIADVHGAPLGKEDVAHIKESFGLDSSKILEVPQEVYDFF
REAVPRGQQLEKDWNGLLSKYSKEHPDLAADLKKRMNGEMLDDWTKYIPKKEDFPTEPTP
SRKSAGAVCNPLAKNVGNFMVGTADLTPSVNMAWKGKVDFQHPDLRTACGINGDYTGRYL
HWGIREHAMASVSNGMAAFKKGCILPVTSSFFMFYIYAAPGVRMGALQSLQVIHIATHDS
IGTGEDGPTHQPIELAALYRAMPNFLYIRPCDGEEAAGAFIAAVGAKNTPSMISVARQNV
EQFPKYSSREGVQKGAYVFIEEQDADVTLIGVGAEMTFAVGAAKVLKDKHGIKARIVSFP
SQRLFEEQPIEYKREVLQYRSNAPRVIIEAYTVNGWERYADAGYSMHTFGHSLPRQYVYG
RFNFDNDKIAAKIQPLVQEVKKNGIESLRGEFRDLNTDYPRDVFHSAFGTSHVVS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggagcctaacgacaggactcaatacgtagttcgatgctaccgcgcactaattgcagat
ctatgccagcaattcaacatgggccacccaggctcggcgatgggtatggcagcaatcggc
gtagcgctctggaagtatgtgatgaagtactcgcccaagaacgccgacttcttcaaccga
gaccgcttcgtcctttccaatggccatgcgtgcctgttccaatacacgttcctacatttg
acgggataccaagccatgacctttgagcaactatctagctatcacagcgagcgatgggac
tcctacacgcctggccacccggagatcgagcatgagggcatcgaagtcacgactggaccg
ctaggccagggtatcgccaacgctgtaggcctggcgatggcgacgaagcatcttggcgct
gtctacaaccggcctggcttcgaaatggtcaacaacatgacgtgggttacgatcggcgac
gcatgcctgcaagaaggcgtcggcatggaagcgattcaacttgccggacattggagactc
gacaatctctgtgtgatctacgacaacaaccagatcacctgtgacggctcagtcgacata
tgcatggcggaagacgtcaacatgaaaatgcgcgccagcggtttcgaagtgctcgaggtc
gaagacggcaaccatgacgtcgaaagcattgtcaaggcgcttgtggctgcccgggctaac
aagaagaggccaacgttcatcaatatcaagaccacgatcggcgtcggcagtaaaaagcaa
ggcatagctgacgttcatggcgcgccgcttggcaaggaggatgtagctcacatcaaggag
agctttggactcgactccagcaaaattctagaggtgccgcaagaagtgtatgacttcttc
cgggaggccgttccgcgtgggcagcagctcgagaaggactggaatggcttgctttctaag
tatagtaaagagcacccagatctggcggcggacctcaagaagcgcatgaatggagagatg
cttgacgactggacaaagtacatcccgaagaaggaggacttccccactgagccgacacca
tcacgcaagtcagctggggcagtctgcaacccgctggcgaagaacgtaggtaacttcatg
gtcggcacggctgacctcacaccctcggtcaacatggcttggaagggtaaggtcgacttc
caacatccagatcttcgaactgcttgcggcatcaatggcgactacactggtcgctacctc
cactggggtatccgcgagcacgccatggcatccgtgtcgaacggtatggcggcgttcaag
aagggatgcatcctgccggtcacgtctagcttcttcatgttctacatctacgcagcgccg
ggagtgcggatgggtgcgctgcagagtctgcaggtcatccacattgctacccacgactcc
atcggcacgggtgaagacggaccgacgcatcagcccatcgagcttgcggcgctgtacagg
gctatgccaaacttcctctatatccgcccttgtgatggcgaagaggcggctggtgccttc
attgccgctgtcggcgccaaaaacacgccttccatgatctccgttgcgcgccagaacgtc
gagcagttcccgaagtattcgagccgcgagggcgtgcagaagggagcctatgtcttcatc
gaggagcaagatgcggacgtcacgcttatcggtgtcggcgcagagatgaccttcgcagtc
ggcgccgcgaaggtattgaaggacaagcacggtatcaaggctcgcatcgtcagcttcccg
tcgcaacgtctcttcgaggagcaaccgatagaatacaagcgtgaagtcctgcaatatcgc
tccaacgcaccgcgcgtcatcatcgaagcatatactgtcaacggctgggaacggtacgcc
gatgctgggtactcgatgcacactttcggccattctttgccacgacaatatgtgtatggc
cgcttcaacttcgacaacgacaagatcgccgccaagatccagccattggtgcaggaggtg
aagaagaacggtatcgagagcctgaggggagagttccgggatctcaataccgactacccg
cgcgacgtctttcatagcgcgtttggaaccagtcatgtagtgtcataa

DBGET integrated database retrieval system