KEGG   Baudoinia panamericana: BAUCODRAFT_79975Help
Entry
BAUCODRAFT_79975  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00430  Taurine and hypotaurine metabolism
bcom00460  Cyanoamino acid metabolism
bcom00480  Glutathione metabolism
bcom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BAUCODRAFT_79975
   00460 Cyanoamino acid metabolism
    BAUCODRAFT_79975
   00480 Glutathione metabolism
    BAUCODRAFT_79975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bcom01002]
    BAUCODRAFT_79975
Enzymes [BR:bcom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BAUCODRAFT_79975
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BAUCODRAFT_79975
Peptidases and inhibitors [BR:bcom01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BAUCODRAFT_79975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept AflR
Motif
Other DBs
NCBI-GeneID: 19117308
NCBI-ProteinID: XP_007681486
JGI: Bauco1_79975
UniProt: M2LBZ7
Position
Unknown
AA seq 592 aa AA seqDB search
MVLLSAPSIAILLLHLLFDVRVSAYILPLLTAQPSTATPAWLQLGPASPTNLLDPERNKL
GAVASESSICSSIGINVLQAGGNAADSLVATVLCVGVIGMYHSGIGGGGFLLVRSSNGSY
EFIDFRETAPAAATQDMYNNNTNSSIYTGLASGVPGELRGLAYLHDNYGLLNWEQVVMPA
VHVARYGFPVTQDLVRYMASAVAGIDNFLVNDPTWAIDFAPNGTLLGLGDTITRKRYADT
LEAIAQRGPDAFYTGPVAQAFIDTVQSNGGIMTMQDLKNYSVAIRPPADITYREFRVRSG
SAPSSGTVLASVMKIVEGYTTIGEAAALNLSTHLFDEALRFAYGQRSELGDPYFVEGMDE
YQTDMLSNETAADIRAKISPLHTLNVSAYDPSGFESLETPGTSAIVTSDLTGMAISLTTT
VNLLFGSHIIVPETGVILNNEMNDFSIPGADNAFGYIPSPSNYIRPGKRPLSSITPTIVE
HANGSLYYVVGAAGGSRIITATLQNLWHVLDQNMTAPEALVMPRLHDQLVPNQVSFEYAY
DNHTVAFMQSRGHNVTWVAPGQSTAQSLRLLGNGTFEAAGEPRQLNSGGYAV
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggtcttgctgtcagctccttcgattgctattctccttctccaccttctgttcgatgtg
agagtctctgcatacatacttccactgcttaccgcgcagccatcgacagcgacaccagca
tggctccaactgggcccagcgtctccgactaaccttttagatcccgaacgcaacaagctc
ggtgcggtggcctctgaaagctcgatatgcagcagtatcggcatcaatgttctgcaagcg
ggtggaaacgccgcggatagtctggtagctaccgttctttgtgttggcgttataggcatg
taccacagcggcatcggtggcggcggctttttgctagttcgaagttccaatggctcatac
gagttcattgactttcgggagacggcacccgctgcagcgacgcaggacatgtataacaac
aacactaacagctcaatctataccggcttagccagtggcgtaccgggagagttgcgcggg
ctcgcctacctgcatgacaattacggcctattgaattgggaacaggtagtgatgcccgca
gttcatgtagcgcggtacggctttccagtcacgcaagaccttgttcgttacatggcttct
gcagttgctggcattgataactttctggtcaacgacccaacctgggcaatagactttgca
ccaaacggcactctccttgggctgggcgacactataactcggaaacggtacgcagatacg
ctggaagcgatcgcgcaaaggggaccggatgctttttatactggacccgtcgctcaagct
ttcatagatacagtccaatctaatggcggcatcatgactatgcaggacctgaaaaactac
tctgtcgccattcggcctccggcagatatcacatatcgtgagtttcgggttcgcagtggt
agtgcgccgtcttcaggaacggtactggcatcagtaatgaagatcgtagaaggctatact
accattggggaagctgctgcgctcaacctcagcacgcacctgttcgatgaagcacttcgt
ttcgcgtatggccagcgctcggagctgggagacccatactttgttgaaggcatggacgag
taccaaacagacatgttgagcaacgagacagcggcagacatccgtgcgaagatcagtccg
ttgcatacactgaatgtctctgcgtatgacccctccggcttcgaatccttggagacacct
ggcacttctgcaattgtcacgagcgatcttaccggcatggcaatctcgctgacgacgacc
gtcaacctgttatttgggtcacacatcatagtgcccgagaccggcgtgatcctcaacaac
gagatgaacgatttctcgatcccgggcgcggacaacgctttcggctacattccctcccca
tccaattacatccggcctggcaagcggccattgtcgtccattacacccaccatagtcgag
cacgcaaacggttcgctgtactatgttgttggtgcagcgggcggtagccggatcattacc
gccaccttgcagaacctctggcacgttctggaccaaaacatgaccgctccggaagctctt
gtaatgccgcgcctacacgatcagttagtgccaaatcaagtcagctttgagtatgcgtac
gacaatcataccgtagcgttcatgcagtcgcgaggacacaacgttacgtgggtcgcgcca
ggtcagtctaccgcgcagtcgctgaggctgctcggcaacggaacgttcgaggcagcaggc
gagccgagacagctgaacagcggtggttatgcggtttag

DBGET integrated database retrieval system