KEGG   Burkholderia contaminans: NL30_02685Help
Entry
NL30_02685        CDS       T03969                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00740  Riboflavin metabolism
bcon00790  Folate biosynthesis
bcon01100  Metabolic pathways
bcon01110  Biosynthesis of secondary metabolites
bcon02024  Quorum sensing
Module
bcon_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NL30_02685
   00790 Folate biosynthesis
    NL30_02685
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NL30_02685
Enzymes [BR:bcon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     NL30_02685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AKM38876
UniProt: A0A0G3YLB8
Position
1:630807..631457
Genome map
AA seq 216 aa AA seqDB search
MMSSRPQSPTQGNDQADECVTLVATASLPTRYGTFKSYAFRVSGSDAEHLALVMGDVAGE
QSVLTRLHSECLTGDVFGSYRCDCGEQLDLALRYIAAEDRGVLLYLRGHEGRGIGLSNKI
RAYALQEQGRDTVEANLDLGLPDDAREYDSAAAILRILGVTSVRLMSNNPAKFDTLAKHG
IPVCERVALAVPVREENERYIRTKQTKFGHYFEENE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcttcgcgtccccaatcgcccacgcagggcaatgaccaggccgacgagtgcgtg
acactcgtcgccaccgcgtcgctgcctacgcgctacggtacgttcaagtcatacgcgttt
cgcgtatcgggcagcgatgccgaacatctcgcgctcgtgatgggcgacgtcgccggcgag
cagtccgtgctgacgcgccttcattccgaatgcctgaccggcgatgtattcggctcgtac
cgctgcgactgcggcgagcagctcgatctcgcattgcgctacatcgcggcggaagaccgc
ggcgtgctgctgtacctgcgcggccatgaagggcgcgggatcggcctgagcaacaagatt
cgcgcttacgcgctgcaggagcaggggcgcgacaccgtcgaggcgaacctcgacctcggc
ctgcccgacgacgcccgcgaatacgattcggccgccgcgattctccggatcctcggcgtg
acgtcggtgcggctgatgagcaacaacccggctaagttcgatacgctcgcgaagcacggc
atccccgtctgcgaacgcgtggcgcttgcagtgcccgtgcgcgaggaaaacgagcgttat
atccgcacgaagcagacgaagtttgggcactacttcgaagaaaacgagtaa

DBGET integrated database retrieval system