KEGG   Burkholderia contaminans: NL30_03660Help
Entry
NL30_03660        CDS       T03969                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NL30_03660
Enzymes [BR:bcon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NL30_03660
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NL30_03660
    1.1.1.-  
     NL30_03660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C DAO NSP10
Motif
Other DBs
NCBI-ProteinID: AKM39052
Position
1:complement(859088..860152)
Genome map
AA seq 354 aa AA seqDB search
MKAAVWHGRHDIRVEQVPVPERPPAGWVTIRVHWCGICGSDLHEYVAGPVFIPVDAPHPL
TGLKGQCILGHEFSGEIAALGAGVTGYAVGDRVTADACQHCGTCWYCKHGLYNICENLAF
TGLMNNGAFAEYVNVPAELLYKLPDDFPTEAGALIEPLAVGLHAVKKAGNIVGQTVVVVG
AGTIGLCTIMCAKAAGAGRVIALEMSAARKQKALEVGASVVIDPKTSDAIAEVKALTGGY
GADVSFECIGHTATAKLAIDVIRKAGKSVMVGIFEEPAPFNFFDIVSTEKEVIGSLAYNG
EFADVIRFIADGRIDVQPLITGRIALGDIVSHGFEELVNHKDRNVKIIVQPALA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgtctggcacggccgccacgatatccgcgtcgaacaggttcccgttccc
gagcgcccgccggcaggctgggtcacgattcgcgtgcactggtgcgggatctgcggctcc
gacctgcacgaatacgtcgcgggccccgtcttcatcccggtcgatgcgccgcatccgctg
acgggcctgaagggccaatgcatcctcggtcacgagttcagcggcgagatcgccgcactc
ggcgcgggcgtgacgggctacgcggtcggcgatcgcgtgacggccgacgcctgccagcat
tgcggcacctgctggtattgcaagcacggcctgtacaacatctgcgagaacctcgcgttc
accgggctgatgaacaacggcgcattcgccgaatacgtgaacgtgccggccgagttgctg
tacaagctgcccgacgacttcccgaccgaggccggcgcgctgatcgaaccgctcgcggtc
gggctgcatgcggtgaagaaggccggcaacatcgtcgggcagaccgtcgtcgtggtcggc
gcgggcacgatcggcctgtgcacgatcatgtgcgcgaaggccgcgggcgccgggcgcgtg
atcgcgctggaaatgtcggccgcgcgcaagcagaaggcgctggaggtcggcgcgagcgtg
gtcatcgatccgaagacgtccgacgcgatcgcggaagtcaaggcgctgaccggcggctac
ggcgccgacgtgtcgttcgagtgcatcgggcacacggccaccgcgaagctcgcgatcgac
gtgatccgcaaggccggcaagtcggtgatggtcgggatcttcgaggagccggcgccgttc
aacttcttcgacatcgtgtcgaccgagaaggaagtgatcggctcgctcgcgtacaacggc
gaattcgcggacgtgatccgcttcatcgcggacggccgcatcgacgtgcagccgctcatc
accgggcgcatcgcgctcggcgacatcgtctcgcacggcttcgaggaactggtcaaccac
aaggaccggaacgtgaagatcatcgtccagcccgccctcgcctga

DBGET integrated database retrieval system