KEGG   Burkholderia contaminans: NL30_06235Help
Entry
NL30_06235        CDS       T03969                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00350  Tyrosine metabolism
bcon00643  Styrene degradation
bcon01100  Metabolic pathways
bcon01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NL30_06235
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    NL30_06235
Enzymes [BR:bcon01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     NL30_06235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C_5 GST_C
Motif
Other DBs
NCBI-ProteinID: AKM39521
Position
1:complement(1446355..1446996)
Genome map
AA seq 213 aa AA seqDB search
MQLHSFFNSSTSYRVRIALALKGLPYDTLPVNIRTGEHREAAYVANVNPSAAVPALVDGD
FRLGQSLAILDYLDQIQPAPRLIPLELRHRARVLELATLIACDIHPLNNLRVLRYLDSEL
KVTPQQKTAWYRHWIAEGMAGVERLLARADEGPWCFGDTPTLADVCLVPQVANALRMDCD
LSAYPRSLAVYEHARHEPAFDAAQPQRQPDFVA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgcaactgcatagcttcttcaatagttcgacatcctaccgggtgcgcatcgcgctcgcg
ctgaaagggctgccttacgacacgctgccggtcaacatccgcaccggcgagcatcgcgag
gcggcgtacgtcgcgaacgtgaacccgtcggccgcggtgccggcgctggtcgatggggat
ttccgtctcgggcagtcgctcgcgatcctcgattacctcgaccagatccagccggcgcct
cgactgattccgctcgaactgcgccatcgtgcccgcgtgctggagctcgcgacgctgatc
gcatgcgacatccatccgctcaacaacctgcgcgtgctgcgctatctcgacagcgaactg
aaggtcacgccgcagcagaagaccgcgtggtaccggcactggatcgcggaagggatggcc
ggcgtcgagcggctgctcgcgcgcgccgacgagggcccgtggtgcttcggcgacacgccg
acgctcgccgacgtgtgcctcgtgccgcaggtcgcgaacgcgttgcggatggattgcgac
ctgagcgcgtatccgcgcagcctcgcggtttatgaacacgcgcggcacgagccggcgttc
gacgcggcgcagccgcagcggcaaccggatttcgtcgcgtaa

DBGET integrated database retrieval system