KEGG   Burkholderia contaminans: NL30_06285Help
Entry
NL30_06285        CDS       T03969                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00040  Pentose and glucuronate interconversions
bcon00053  Ascorbate and aldarate metabolism
bcon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NL30_06285
   00053 Ascorbate and aldarate metabolism
    NL30_06285
Enzymes [BR:bcon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     NL30_06285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Adeno_E1B_55K_N
Motif
Other DBs
NCBI-ProteinID: AKM39530
Position
1:1456764..1458356
Genome map
AA seq 530 aa AA seqDB search
MQLTGHLLIGQSAVAGQNGTLHAIAAATGERLEPAFGGASLHDLETACALADDAFDTYRE
TSLEARAAFLDAIGRHIMALGDELIERCVIETGLPRARIEGERGRTVGQLALFASLVRDG
GFLGARIDPARPERKPLPRVDLRLRNVAVGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VIVKAHSAHPGTSALVGRAIQQAARESGMPAGVFSLLFDASREIGQALVADPRIKAVGFT
GSRRGGVALMHIAAARPEPIPVYAEMSSINPVLLFPAALDARHDAIAPQFVASLTLGAGQ
FCTNPGLVLAVDGPALRAFEEAAAAAVRAAPAQTMLTPHIHASYEQGVAALRGHAAVELL
AQGAEGNRLQARAALLATSAEAFITHPELRDEVFGPASLIVRCPDADTLHRVLKSLEGQL
TIAAHLADGDAPLFAALRPLLERKAGRILVNGFGTGVEVGHAMVHGGPFPATSDTRTTSV
GARAIERFLRPVSYQDLPDALLPEAIRSGNPLNVPQRIDGVPAPRGANHV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttacaggtcatctcctgatcggccagtccgccgtcgccggacagaacggcacc
ctccacgcgatcgccgccgccaccggcgaacggctcgaacccgccttcggcggcgcgagc
ctgcacgacctggagacggcctgcgcgctcgccgacgacgccttcgacacgtatcgcgaa
acgtcgcttgaagcccgcgccgcgtttctcgacgcaatcggccgccacatcatggcgctc
ggcgacgaactgatcgagcgctgcgtcatcgaaacgggcctgccgcgcgcccgcatcgaa
ggcgagcgcggccgcacggtcggccagctcgcgctgttcgcgtcgctcgtgcgcgacggc
ggttttctcggcgcgcggatcgatccggcgcgccccgagcgcaagccgctgccgcgcgtc
gacctgcgcctgcgcaacgtcgcggtcgggcccgtggccgtgttcggtgcgtcgaacttt
ccgctcgcgttctcggtcgccggcggcgataccgcctcggcgctcgcggccggctgcccg
gtgatcgtcaaggcgcattcggcgcaccctggcacgtcggcgctcgtcggccgcgcgatc
cagcaggccgcgcgtgaaagcgggatgccggccggcgtgttctcgctgctgttcgacgcg
tcgcgcgagatcggccaggcgctggtcgccgatccgcgcatcaaggcggtcggcttcacc
ggctcgcgtcgcggcggcgtcgcactgatgcacatcgcggccgcccgccccgagccgatt
ccggtctatgcggaaatgagctcgatcaatcccgtgctgctgtttcccgccgcgctcgac
gcgcgccacgatgcgatcgcgccgcagttcgtcgcgtcgctcacgctcggcgccgggcag
ttctgcacgaacccgggcctcgtgctcgccgtcgacgggcccgcgctgcgcgcgttcgag
gaagcggccgccgctgcggtgcgtgccgcgcccgcgcaaacgatgctgacgccgcacatc
catgccagctacgaacagggcgtcgcggcgcttcgcggtcacgctgccgtcgagctgctc
gcgcaaggcgccgaaggcaatcgcctgcaggcccgcgcggcactgctggcgacctcggcc
gaggcgttcatcacgcaccccgaattgcgcgacgaagtgttcggccccgcttcgctgatc
gtgcgctgcccggacgccgacacgctgcatcgcgtactgaagtcgctcgagggccagctg
acgatcgccgcacacctcgccgacggcgacgcgccgctgttcgccgcgctgcgcccgctg
ctcgagcgcaaggccggccgcattctcgtcaacggcttcggcacgggcgtcgaggtcggc
catgcgatggtgcacggcggcccgtttccggcgacgtccgacacgcgcacgacctccgtc
ggcgcgcgcgcgatcgagcgcttcctgcgccccgtgtcttatcaggacctgccggacgcg
ctgctgccggaagcgatccgcagcggcaatccgctgaacgtgccgcaacgtatcgacggc
gtgcccgcgccgcggggggcgaaccatgtctga

DBGET integrated database retrieval system