KEGG   Burkholderia contaminans: NL30_08375Help
Entry
NL30_08375        CDS       T03969                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00072  Synthesis and degradation of ketone bodies
bcon00280  Valine, leucine and isoleucine degradation
bcon00650  Butanoate metabolism
bcon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NL30_08375
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    NL30_08375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NL30_08375
Enzymes [BR:bcon01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     NL30_08375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AKM39918
UniProt: A0A0G3YR93
Position
1:complement(1940492..1941133)
Genome map
AA seq 213 aa AA seqDB search
MAWNRDQMAARAAKELQDGFYVNLGIGLPTLVANHVPEGVEVWLQSENGLLGIGPSPTED
EVDADLINAGKQTVTTLPGSSIFSSADSFAMIRGGHINLAILGAMQVSKQGDLANWMIPG
KMIKGMGGAMDLVAGVKRVVVLMEHVAKGDQHKILEECNLPLTGVGVVDLIITDLGVIEV
TPNGLKVLELADGVSVDEIKAKTGAPLDVSAVG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaatcgtgaccagatggccgcgcgcgcggcgaaggaactgcaggacggcttc
tacgtgaacctcggcatcggcctgccgacgctcgtagcgaaccacgtaccggaaggcgtc
gaggtgtggctgcagtcggagaacggcctgctcggcatcggcccgtcgccgaccgaagac
gaagtcgatgctgacctcatcaacgccggcaagcagaccgtcacgacgctgccgggctcg
tcgatcttctcgtcggccgattcgttcgcgatgatccgcggcggccacatcaacctcgcg
atcctcggcgcgatgcaggtcagcaagcagggcgacctcgcgaactggatgatccccggc
aagatgatcaaggggatgggcggcgcaatggatctcgtcgccggcgtgaagcgcgtggtc
gtgctgatggagcatgtcgcgaagggcgaccagcacaagatcctcgaggagtgcaacctg
ccgttgacgggtgtcggcgtggtcgacctgatcatcaccgatctcggcgtgatcgaggtg
acgccgaacggcctgaaggtcctcgaactcgccgatggcgtgagcgtcgacgaaatcaag
gcgaagacgggcgcaccgctcgacgtgagcgcggtgggctga

DBGET integrated database retrieval system