KEGG   Burkholderia contaminans: NL30_09750Help
Entry
NL30_09750        CDS       T03969                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bcon  Burkholderia contaminans
Pathway
bcon02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NL30_09750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcon02000]
    NL30_09750
Enzymes [BR:bcon01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     NL30_09750
Transporters [BR:bcon02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    NL30_09750
   Histidine transporter
    NL30_09750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_29 AAA_15 AAA_16 AAA_23 APS_kinase AAA_28 DUF87 AAA_33 PRK G-alpha FtsK_SpoIIIE AAA_22 NACHT AAA_24 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AKM40169
UniProt: A0A3N8SZ19
Position
1:complement(2261689..2262489)
Genome map
AA seq 266 aa AA seqDB search
MAEITQTSAAASTKLAAVDIHKRYGDNEVLKGVSLNAKAGDVISIIGASGSGKSTFLRCI
NFLERPNAGQIVVDGEAVRTKTDRAGALEVADHKQLQRIRTKLAMVFQHFNLWAHMNVLE
NVMEAPLHVLGVSKKEAEERAREYLEKVGLPPRVEKQYPSHLSGGQQQRVAIARALAMHP
DVMLFDEPTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRTE
EEGDPKEVLVRPQSERLKQFLSGSLK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttggccgagatcactcaaacgagcgctgccgcttccaccaagcttgccgcggtcgacatt
cacaagcgctacggtgacaacgaagtgctcaagggcgtatcgctgaacgcgaaggccggc
gacgtcatcagcatcatcggcgcgagcggctcgggcaagagcacgttcctgcgctgcatc
aattttctcgagcggccgaatgcggggcagattgtcgtggacggcgaggccgtgcgcacg
aagaccgaccgcgccggtgcgctcgaagtcgccgatcacaagcaactgcagcgcattcgc
acgaagctcgcgatggtgttccagcacttcaacctgtgggcgcacatgaacgtgctcgag
aacgtgatggaagcgccgttgcacgtgctcggcgtttcgaagaaggaagccgaggagcgg
gcgcgcgagtacctggagaaggtcggcttgccgccgcgcgtcgagaagcagtatccgtcg
catctgtcgggcggccagcagcagcgggttgcgatcgcgcgtgcgcttgcgatgcatccg
gacgtgatgctgttcgacgagccgacgtcggcgctcgacccggagttggtcggtgaagtg
ctgaaggtgatgcagaagctggccgaggaagggcgcacgatgatcgtcgtcacgcacgag
atgggtttcgcgcgcaacgtgtcgaatcatgtgatgttcctgcaccaggggcggaccgag
gaagagggcgatccgaaggaagtgctggtacgcccgcagagcgagcggctgaagcagttc
ctgtcgggcagcctcaagtaa

DBGET integrated database retrieval system