KEGG   Burkholderia contaminans: NL30_13280Help
Entry
NL30_13280        CDS       T03969                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00071  Fatty acid degradation
bcon00072  Synthesis and degradation of ketone bodies
bcon00280  Valine, leucine and isoleucine degradation
bcon00310  Lysine degradation
bcon00362  Benzoate degradation
bcon00380  Tryptophan metabolism
bcon00620  Pyruvate metabolism
bcon00630  Glyoxylate and dicarboxylate metabolism
bcon00640  Propanoate metabolism
bcon00650  Butanoate metabolism
bcon00900  Terpenoid backbone biosynthesis
bcon01100  Metabolic pathways
bcon01110  Biosynthesis of secondary metabolites
bcon01120  Microbial metabolism in diverse environments
bcon01130  Biosynthesis of antibiotics
bcon01200  Carbon metabolism
bcon01212  Fatty acid metabolism
bcon02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NL30_13280
   00630 Glyoxylate and dicarboxylate metabolism
    NL30_13280
   00640 Propanoate metabolism
    NL30_13280
   00650 Butanoate metabolism
    NL30_13280
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NL30_13280
   00072 Synthesis and degradation of ketone bodies
    NL30_13280
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NL30_13280
   00310 Lysine degradation
    NL30_13280
   00380 Tryptophan metabolism
    NL30_13280
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NL30_13280
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NL30_13280
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NL30_13280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcon04147]
    NL30_13280
Enzymes [BR:bcon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NL30_13280
Exosome [BR:bcon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NL30_13280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKM40787
UniProt: A0A0G3YTR2
Position
1:3006785..3007963
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTPLAKSWRGAFNMTHGATLGGHAVAAAVERAKLDPARVEDVIMGCANPE
GATGANIARQIALRAGLPVTVPGMTVNRFCSSGLQTIALAAQRIIAGEGEVYVAGGVESI
SCVQNEMNHHMIQEGWLVQHKPEIYWNMLQTAENVAKRYGISKERQDEYGVQSQLRAAAA
QEAGRFRDEIVPITVLAGVADKATGRLFTKEVTVSADEGIRPDTTLEGVSKIRSAVPGGV
ITAGNASQFSDGASACVVMSADAARREGLQPLGVFRGFAVAGCEPDEMGIGPVFAVPKLL
KQAGLKVDDIGLWELNEAFAVQVLYCRDTLGIPEDRLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGVKYVVVTMCIGGGQGAAGLFEIL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcccgcacgccgctggcgaaatcctggcgcggt
gctttcaacatgacgcacggcgcgacgctcggcggccacgcggtcgcggccgctgtcgaa
cgcgcgaagctcgaccccgcacgcgtcgaggacgtgatcatgggttgcgcgaaccccgag
ggcgcgaccggcgcgaacatcgcgcggcagatcgcactgcgcgcggggctgcccgtgacg
gtgccggggatgaccgtgaaccgtttctgctcgtccgggctgcagaccatcgcgctggcc
gcgcagcggatcatcgcgggcgaaggcgaagtgtatgtggcgggcggcgtcgaatcgatc
tcgtgcgtgcagaacgagatgaaccaccacatgatccaggaaggctggctcgtccagcac
aagcccgagatctactggaacatgctgcagacggccgagaacgttgcgaagcgctacggc
atctcgaaggagcggcaggacgagtacggcgtgcagtcgcaattgcgcgccgcggctgcg
caggaagccgggcgcttccgcgacgagatcgtgccgatcaccgtgctcgcgggcgttgcc
gacaaggcgacgggccgcctgttcacgaaggaagtgacggtctcggccgacgaagggatc
cgccccgacacgacgctcgaaggcgtgtcgaagattcgctcggccgtgccgggcggcgtg
atcaccgcgggcaacgcgagccagttctcggacggcgcgtcggcctgcgtcgtgatgagc
gccgacgccgcgcggcgcgaaggactgcaaccgctcggcgtgttccgcggtttcgcggtg
gccggttgcgagccggacgagatgggcatcggccccgtgttcgcggtgcccaagctgctg
aagcaggcggggctgaaggtcgacgatatcggcctgtgggaattgaacgaagcattcgcg
gtgcaggtgctgtactgccgcgacacgctcgggattcctgaggatcgtctgaacgtgaac
ggcggcgcgatcgcggtcggccatccgtacggtgtgtcgggcgcacgcctgacgggccat
gcgctgatcgaaggcaagcggcgcggcgtgaagtacgtggtcgtcacgatgtgtatcggc
ggcggacagggcgcggccgggctgttcgaaatcctctga

DBGET integrated database retrieval system