KEGG   Burkholderia contaminans: NL30_13715Help
Entry
NL30_13715        CDS       T03969                                 

Definition
(GenBank) stationary phase survival protein SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00230  Purine metabolism
bcon00240  Pyrimidine metabolism
bcon00760  Nicotinate and nicotinamide metabolism
bcon01100  Metabolic pathways
bcon01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NL30_13715
   00240 Pyrimidine metabolism
    NL30_13715
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NL30_13715
Enzymes [BR:bcon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     NL30_13715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AKM40869
Position
1:3094356..3095117
Genome map
AA seq 253 aa AA seqDB search
MRILLSNDDGYLAPGLAALSDALQPLAELTVIAPEQNCSGASNSLTLSRPLSVQRAASTG
FFYVNGTPTDSVHVALTGMADASPDLVVSGINNGQNMGEDTLYSGTVAAATEGIMFGVPA
IAFSLVDKGWAHLADAARVAAEIVEHYLAHPLPGQPLLNVNIPNLPYDELKGWKVTRLGK
RHPSQPVIRQTDPRGETIYWIGAAGEALDASDGTDFHAVANGFVSITPLQLDLTHTQMLP
ATREWARAGGRAS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcctactcagcaacgacgacggctatctcgcccccggtctcgcggcgctcagc
gacgcgctgcagccgctggccgagctcacggtgatcgcgcccgagcagaactgcagcggc
gcatcgaattccctcacgttgtcgcggccgctgtcggtgcagcgcgcggcgagtacgggt
ttcttctacgtgaacggcacgccgaccgattcggtacacgtcgcgttgacggggatggcc
gacgccagcccggacctcgtcgtttccgggatcaacaacggccagaacatgggcgaagac
acgctctattcggggacagttgcggccgccaccgaaggcatcatgttcggcgtgccggcc
atcgcattctcgctggtcgacaagggctgggcccatctggcggacgcagcgcgcgtcgcc
gcggaaatcgtcgagcactatctcgcgcatccgctgccgggccagccgctgctcaacgtc
aatattccgaacctgccgtacgacgaactgaaaggctggaaggtcacgcgactcggcaag
cgtcatccgtcgcagccggtgattcgccagaccgacccgcgcggtgaaacgatctactgg
atcggcgcggcgggtgaagcgctggacgccagcgacggcaccgattttcacgcagtggca
aacggtttcgtgtcgatcacgccgctgcagctggacctcacgcatacgcagatgctgccc
gcgacgcgcgaatgggcgcgcgccggagggcgggcttcatga

DBGET integrated database retrieval system