KEGG   Burkholderia contaminans: NL30_13825Help
Entry
NL30_13825        CDS       T03969                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00230  Purine metabolism
bcon00250  Alanine, aspartate and glutamate metabolism
bcon01100  Metabolic pathways
Module
bcon_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NL30_13825
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NL30_13825
Enzymes [BR:bcon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     NL30_13825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AKM40890
UniProt: A0A0G3YTY5
Position
1:3116928..3118274
Genome map
AA seq 448 aa AA seqDB search
MSASAVNVTPGRNVVVVGTQWGDEGKGKIVDWLTDHAQGVVRFQGGHNAGHTLIIGGKKT
ILRLIPSGIMREGVACYIGNGVVLSPEALFKEIGELEEAGVNVRDRLFISEATTLILPYH
IAIDQAREARKGAGKIGTTGRGIGPAYEDKVGRRALRVQDLFDAKTFADRLRENLDFHNF
VLTQYLGGAAVDFQATLDTMLGYADRLKPMVADVSRRLYDANNAGQNLLFEGAQGTLLDI
DHGTYPFVTSSNCVAGAASAGAGVGPQKLNYILGITKAYCTRVGSGPFPSELYDADNPQR
QDQVGVTLANVGKEFGSVTGRPRRTGWLDAAALRRSIQINGVSGLCMTKLDVLDGLDEVK
LCVGYKIDGKDVDILPRGAADVARCEPVYETFAGWKESTVGIKTWEALPANAQAYLTRVQ
EVAGVPVDMVSTGPDRDETILLRHPFKV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccagcgcagtgaacgtgactcccgggcgcaatgtcgtcgtcgtgggaacgcaa
tggggtgatgaaggcaagggcaagatcgtcgactggctgacggaccacgctcagggcgtc
gtgcgtttccagggcggtcacaacgccggccacaccctcatcatcggcggcaagaaaacg
atcttgcgcctcattccgtcgggcatcatgcgtgaaggcgtcgcctgctacatcggcaac
ggcgtcgtcctgtcccccgaagcactgttcaaggaaatcggcgagctggaagaagccggc
gtgaacgtgcgcgaccgcctgttcatttccgaagccacgacgctgatcctgccgtaccac
atcgcgatcgaccaggcgcgcgaagcgcgcaagggcgcgggcaagatcggcacgacgggc
cgcggcatcggccccgcgtacgaagacaaggtcggccgccgcgcgctgcgtgtgcaggac
ctcttcgatgcgaagaccttcgccgaccgcctgcgcgaaaacctcgatttccacaacttc
gtgctgacccagtacctgggcggcgcggctgtcgatttccaggccacgctcgacacgatg
ctgggttatgccgaccgcctgaagccgatggtggccgacgtgtcgcgccgcctgtacgac
gcgaacaatgcgggccagaacctgctgttcgaaggcgcacaaggtacgctgctcgacatc
gaccacggcacctatccgttcgtcacgtcgagcaactgcgtcgcaggtgcggcgtcggct
ggcgcgggcgtgggtccgcagaagctcaactacatcctcggcatcacgaaggcatattgc
acgcgcgtcggctcgggcccgttcccgagcgaactgtacgatgcggacaacccgcagcgt
caggaccaggttggcgtcacgctcgctaatgtcggcaaggaattcggttcggtcaccggc
cgtccgcgccgcacgggctggctcgacgcagccgcgctgcgccgctcgatccagatcaac
ggcgtgtcgggcctgtgcatgacgaagctcgacgtgctggacggcctcgacgaagtcaag
ctgtgcgtcggctacaagatcgacggcaaggatgtggacatcctgccgcgcggcgccgct
gatgtggcccgttgcgagcccgtatacgaaacgtttgccggctggaaggaaagcacggtc
ggcatcaagacgtgggaagccctgccggcgaacgcgcaggcttacctgacccgtgtccag
gaagtggctggcgtgccggtcgacatggtgtcgacgggtccggaccgcgacgaaacgatc
ctgctccgccatccgttcaaggtgtaa

DBGET integrated database retrieval system