KEGG   Burkholderia contaminans: NL30_17195Help
Entry
NL30_17195        CDS       T03969                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00260  Glycine, serine and threonine metabolism
bcon01100  Metabolic pathways
bcon01110  Biosynthesis of secondary metabolites
bcon01120  Microbial metabolism in diverse environments
bcon01130  Biosynthesis of antibiotics
bcon01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NL30_17195
Enzymes [BR:bcon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     NL30_17195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AKM41695
Position
2:complement(338017..339030)
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTRPSQAMLAAMTAAETGDDVWGDDPTVLRLQAVTAERAGKEAGLFFPSGTQ
SNLAALMAHCERGDEYIVGQLAHTYKYEGGGAAVLGSIQPQPIENAPDGTLPLAKIAAAI
KPLDNHFARTRLLALENTIGGQVLPEGYVQEATALARSRGLSLHLDGARVCNAAIASGRS
IAELGAPFDSVSICFSKGLGAPVGSVLVGNRALIERAQRWRKVLGGGMRQSGILAAACLY
ALDHNVARLADDHANAAHLAEGLARIDSVKVLSHATNMVFAQFPEADCAPLEAWLKERGI
LTQMLYASRFVTHCDVSRADIDTFIDAVGAYFAQRRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgtgacacgtccgagccaggcaatgctggccgcgatg
actgccgccgaaaccggcgacgacgtatggggtgacgacccgaccgtgctgcgcctgcag
gcggtgacggccgagcgggccggcaaggaagccggcctgttcttcccgagcggcacgcag
agcaacctggccgcgctgatggcccattgcgagcgcggcgacgagtacatcgtcggccag
ctcgcgcatacctacaagtacgaaggcggcggcgcggccgtgctgggcagcatccagccg
cagccgatcgagaacgcgccggacggcacgctgccgctcgcgaagatcgctgcggcgatc
aagccgctcgacaatcactttgcccgcacgcgcctgctcgcgctcgaaaacacgatcggt
gggcaggttttgccggaaggctatgtgcaggaagcgaccgcgctcgcgcgcagccgcggg
ttgtccctgcacctcgacggcgcgcgcgtgtgcaacgcggccatcgcgtcgggccgttcg
atcgccgaactgggcgcgccgttcgacagcgtgtcgatctgcttctcgaaagggctcggc
gcaccggtcggctcggtgctggtcggcaatcgcgcgctgatcgagcgcgcgcagcgctgg
cgcaaggtgctcggcggcggcatgcggcagtcgggcattctcgcggccgcatgcctgtat
gcgctcgaccacaatgtcgcacggctcgcggacgatcatgcgaatgcggcgcatctcgcc
gaaggcctcgcgcgcatcgactccgtgaaggtgctgtcacacgcgacgaacatggtgttc
gcgcaattccccgaagccgattgcgcgccgctcgaggcgtggctcaaggaacgcgggatc
ctcacgcagatgctgtacgcgtcgcgcttcgtcacgcactgcgacgtgtcgcgcgcggac
atcgatacgttcatcgacgcggtcggtgcgtatttcgcgcaacgccgcgcgtaa

DBGET integrated database retrieval system