KEGG   Burkholderia contaminans: NL30_17475Help
Entry
NL30_17475        CDS       T03969                                 

Definition
(GenBank) phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00562  Inositol phosphate metabolism
bcon00564  Glycerophospholipid metabolism
bcon00565  Ether lipid metabolism
bcon01100  Metabolic pathways
bcon01110  Biosynthesis of secondary metabolites
bcon02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NL30_17475
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NL30_17475
   00565 Ether lipid metabolism
    NL30_17475
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NL30_17475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bcon02042]
    NL30_17475
Enzymes [BR:bcon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     NL30_17475
Bacterial toxins [BR:bcon02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   NL30_17475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: AKM41748
Position
2:404266..406605
Genome map
AA seq 779 aa AA seqDB search
MTSRRKFLQQTATSGLAAAALSAFPPSIRRALAIPAFHETGTIKDVKHVVLLMMENRAFD
SYFGTFKGVRGYGDRFAVPSPNGRDVFYQTYTKATPATTVTPYHLDASQGNAQRAGGTPH
TWADSQAAWDHGRMNRWPDAKTPLSMGYYDAAEVPFQRALADAFTLCDHYHCGMHTGTIA
NRLFYWSGTNGPNGISPADGSRVKIAALNNQFNGGNDIGPSSQGWTWTTYADRLQQVGVN
WKVYQSLIDNFGCNEMMSFRHWRAAIEQMPPARRPAYVASTDITQPVTAAGAFYDPAIDD
PLSPLAKGFGNTMPYGFLESFRDDIRNGTLPEVSWIIPPSAYSEHPGPSSPAQGGWYVQA
VLDALTANPEVWSKTVLLVNYDENDGFFDHMPSPAVPSRNADGTLAGGHTLRDADVAAEY
HDFTPATSSQPAIDGRPYGPGPRVPMWVVSPWSRGGWVNSQVFDHTSTLLFLEKRFGVAE
PQISAYRRAVCGDLTSAFNFRSPNNEPLPTLAGHTTKGQVDALSAAQQAAPKIVPPAAPS
LPAQAIGVRPSRALPYELHASARADAGNGTVTLKFANTGRAAAVFHVYDKLHLDRLPRRY
VVEPGKTLHGDWAARADNGGKYDLWVLGPNGYHRRFTGDLSRLAGARAPQPEVRIGYAGA
SGNLHLKLRNHGGGTVRFTVKSNQVYGPLSGGGAHDDRGHGQGNENGGSHGHGTGTTWTV
TVRAGDQAELHWKLDSTGHWYDFIVTADSDPSFSRRVAGRVETGRHSVSDPAMGLADRF
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacgccgcaaattccttcagcagaccgccacttccggcctcgccgccgccgcg
ctgtccgcgtttccaccgagcatccgccgcgcgctcgcgattcccgcgtttcacgagacg
gggaccatcaaggacgtgaagcacgtcgtgctgctgatgatggagaaccgcgcattcgac
agctacttcggcacgttcaagggcgtgcgcggttacggcgaccgctttgcggtgccgtcg
ccgaacggccgcgacgtgttctaccagacatacacgaaggcgacgcccgccaccaccgtc
acgccgtatcacctcgacgcgagccagggcaacgcgcagcgcgcgggcggcacgccgcac
acgtgggccgattcgcaggccgcgtgggaccacggccggatgaaccgctggcccgacgcg
aagacgccgctgtcgatgggttactacgacgcggcggaagtaccgttccagcgcgcgctc
gccgatgcgttcacgctgtgcgaccactaccactgcgggatgcacacgggcacgatcgcg
aaccgcctgttctactggagcggcaccaacggcccgaacggcatcagcccggccgacggc
agccgcgtgaagatcgccgcgctgaacaaccagttcaacggcggcaacgacatcggcccg
tcgagccagggctggacctggaccacctatgccgaccggctgcagcaggtcggcgtgaac
tggaaggtgtaccagagcctgatcgacaacttcggctgcaacgagatgatgagcttccgc
cactggcgcgcggcgatcgagcagatgccgcccgcgcgccggcccgcgtacgtcgcatcg
accgacatcacgcagcccgtgacggcggccggtgcgttctacgacccggcgatcgacgat
ccgctgagcccgctcgccaaggggttcggcaacacgatgccgtacggcttcctcgaatcg
ttccgcgacgacatccgcaacggcacgctgcccgaggtgtcgtggatcatcccgccgtcc
gcgtacagcgaacatccggggccgtcgagccccgcgcagggcggctggtacgtgcaggcc
gtgctcgatgcgctgacggcgaacccggaggtgtggagcaagaccgtgctgctggtgaac
tacgacgagaacgacggcttcttcgaccacatgccgtcgccggccgtgccgtcgcgcaac
gccgacggcaccctcgcgggcggccatacgctgcgggatgccgacgtcgccgccgagtac
cacgacttcacgccggccacgtcgagccagccggcgatcgacggccgtccgtacggcccg
ggcccgcgcgtgccgatgtgggtcgtgtcgccgtggagccgcggcggctgggtcaactcg
caggtattcgaccatacgtcgacgctgctcttcctcgagaagcgcttcggcgtcgcggag
ccgcagatcagcgcgtaccgccgcgcggtgtgcggcgacctgacgagcgcgttcaacttc
cgctcgccgaacaacgaaccgctgccgacgctcgcgggccatacgacgaaaggccaggtc
gacgcgctgagcgccgcgcaacaggccgcgccgaagatcgtgccgccggccgcgccgtcg
ctgcccgcccaggcgatcggcgtgcgcccgtcgcgggcgctgccttacgaactgcacgcg
agcgcgcgtgccgatgccggcaacggcacggtcacgctgaagttcgcgaacacgggccgc
gccgccgccgtgtttcacgtctatgacaagctgcatctcgaccgcctgccgcggcgctac
gtcgtcgaaccgggcaagacgctgcacggcgactgggccgcgcgcgccgacaacggcggt
aaatatgacctgtgggtgctgggcccgaacggctatcaccgccgcttcaccggcgacctc
agccgcctggccggtgcacgcgcgccgcagccggaagttcgcatcggctatgcgggggcg
agcggcaacctccacctgaagctgcgcaaccacggcggcggcacggtgcgcttcaccgtg
aagtcgaatcaggtctacgggccgctgtccggcggcggggcgcatgacgatcgcggtcat
ggccagggcaacgaaaacggcggcagccatggccatggtaccggtaccacgtggacggtg
acggtgcgcgccggcgaccaggccgagttgcactggaagctcgactcgaccggccactgg
tacgacttcatcgtcaccgcggacagcgacccgagtttctcgcgccgcgtcgctggccgt
gtcgaaaccggccgccactcggtcagcgacccggcaatggggctcgccgaccgcttctga

DBGET integrated database retrieval system