KEGG   Burkholderia contaminans: NL30_19115Help
Entry
NL30_19115        CDS       T03969                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bcon  Burkholderia contaminans
Pathway
bcon00360  Phenylalanine metabolism
bcon00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcon00790  Folate biosynthesis
bcon01100  Metabolic pathways
bcon01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    NL30_19115
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NL30_19115
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NL30_19115
Enzymes [BR:bcon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     NL30_19115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AKM44183
Position
2:796338..797231
Genome map
AA seq 297 aa AA seqDB search
MSTVVTAKLQEQFDAGLETRADFTIDQPFARYGQVDHAVWKQLYARQSALLRGRACDAFV
AGLGKIDLPADRVPSFADVNRQLKPATGWEIVAVPGLVPDRVFFEHLANRRFPVTWWMRR
PDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMQAYGRTALAVADDEAALTRLARLYWYTV
EFGLIRDPRGTNGLSIYGAGIVSSKGESLYSLESAAPNRLGFDLERVMRTKYRIDTFQKT
YFVIDDFAQLFALADVDGRALADRLAALPEFAAGAVLDTDRVLHRGTGEGWPDDADA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcgtcaccgcgaaactgcaggagcagttcgatgcgggcctcgaaacccgc
gccgatttcaccatcgatcagccgttcgcgcgttacggccaggtcgaccacgcggtgtgg
aagcagctctatgcacgccagtcggcgctgttgcgcgggcgcgcatgcgacgcgttcgtc
gctggactggggaagatcgacctgccggccgaccgcgtgccgtcgttcgccgacgtgaac
cgtcagttgaaaccggcgacgggctgggagatcgtcgcggtgccgggcctcgtgcccgac
cgggttttcttcgagcatctcgcgaaccggcgcttccccgttacctggtggatgcgccgt
cccgaccagctcgactacctgcaggaacccgactgcttccacgacctgttcggccacgtg
ccgctgctgatcgacccggtgttcgccgactacatgcaggcgtacggccgcaccgcgctc
gcggtcgccgacgatgaagcggcgctgacgcgcctcgcgcggctctactggtatacggtg
gaattcgggctgatccgcgacccgcgcggcacgaacgggctgtcgatctacggcgccggg
atcgtgtcgagcaagggcgaaagcctgtacagcctcgaaagcgcggcgccgaaccggctc
ggtttcgacctcgagcgcgtgatgcgcacgaagtaccggatcgacaccttccagaagacc
tacttcgtgatcgacgatttcgcgcagctgttcgcgctcgccgacgtcgacggccgtgcg
ctggccgaccggctggcggcgctgcccgagtttgccgccggcgcggtgctcgatacagat
cgcgtgctgcatcgcggcacgggcgaaggctggccggacgacgccgacgcgtga

DBGET integrated database retrieval system