KEGG   Bifidobacterium coryneforme: BCOR_0244Help
Entry
BCOR_0244         CDS       T03236                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
bcor  Bifidobacterium coryneforme
Pathway
bcor00970  Aminoacyl-tRNA biosynthesis
bcor01100  Metabolic pathways
bcor01110  Biosynthesis of secondary metabolites
bcor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCOR_0244
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCOR_0244
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcor01007]
    BCOR_0244
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcor03016]
    BCOR_0244
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bcor02048]
    BCOR_0244
Enzymes [BR:bcor01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BCOR_0244
Amino acid related enzymes [BR:bcor01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BCOR_0244
Transfer RNA biogenesis [BR:bcor03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BCOR_0244
 Prokaryotic type
   Other AARSs
    BCOR_0244
Prokaryotic defense system [BR:bcor02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BCOR_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AII74264
UniProt: A0A076JH26
Position
309997..311523
Genome map
AA seq 508 aa AA seqDB search
MTDEHDHDSKPELPKDLRVRFCPSPTGTPHVGMVRTALFNWAQARHSKGTFVFRIEDTDA
QRDSEESYGQILDALRWLGLDWDEGVEVGGPDGPYRQSLRGDIYKKVAQQLVDAGYAYES
YSTADEIKERNVAAGRPEAFGYDGYDRDLSEEERQAFRDQGRKPALRISMPDEDIAFDDL
IRGRIEFKAGSVPDYVIVRPNGDPLYTLTNPVDDAMMRINVVLRGEDLLSSTPRQIVLYR
YLMELGVAQAMPLFGHMPYVMGQGKKKLSKRDPESNLFLHREHGFIREGLLNYLALLGWS
IGPDRDVFSMDEMIERFDVRDVKANPAHFDIDKAIAINAEHIRMLDPQDFLNRSLPYLKR
DGLVTAESWDDLTDREREVLTAAGPLVQPRVRLLGEVSGMMGSLLSDADYIEPDPDARKQ
LKESAAAVLELAEQTLREVPDQSWTTDHLHDLLTEALVEQGEYKPRLAFGPVRIAVSGRR
VSPPLFESLEIIGKTATLQRLTNLRQHL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgactgatgagcatgatcacgactcgaaacccgaactgcccaaggatctgagggtgcgg
ttctgcccttcccccacgggcaccccccacgtgggcatggtccgtacggccctcttcaac
tgggcccaggcccgtcattccaaggggaccttcgtcttccgaatcgaggacacggatgcc
cagcgcgacagcgaggagagctacgggcagatcctggatgccctgagatggctggggctt
gactgggatgaaggggtggaggtaggtggccccgatggtccctaccgccagtccctgcgg
ggcgacatctacaagaaggtcgcccagcagctcgtggatgccggctacgcgtacgaatcc
tattccaccgcggacgaaatcaaggagcgcaacgtcgccgccgggcgacccgaggccttc
gggtatgacgggtacgaccgggacctgagcgaggaggagcgacaggctttccgcgaccag
ggccgtaagcccgccctgcgtatcagcatgcccgatgaggacattgccttcgacgatctg
attcgaggccggattgaattcaaggccggatcggtgcccgactatgtgattgtccgcccg
aatggggaccccctctataccctgaccaacccggttgatgatgccatgatgcggataaac
gtggttctgcgcggggaggacctcctcagctccacgcccaggcagatcgttctttaccgg
tatctgatggaattgggtgtcgcccaggccatgcccctcttcggccacatgccctatgtg
atgggtcagggcaagaagaagctctccaagcgcgatcccgagtccaacctcttcctgcac
cgtgagcatggcttcatccgcgagggtctcctgaactacctggccctcctgggctggtcg
ataggccccgaccgcgatgtcttctccatggatgagatgattgagcgcttcgatgttcgc
gatgtcaaggccaatccggctcatttcgacatcgacaaggccatcgccatcaatgccgag
cacatccgtatgctggatccgcaggatttcctgaatcgatccctgccttatctgaagcgt
gatggtctggtcactgccgagagttgggatgacctgaccgaccgtgagcgtgaggtcctg
acggcggccggccccctggtccagccccgtgtccgtcttctgggcgaggtctccgggatg
atggggagcctgctcagtgatgccgattacatcgagcccgacccagacgcacgcaagcag
ctcaaggagtcggccgctgccgttctggagctggccgagcagacgctccgggaggtgccc
gaccagagttggaccaccgaccatcttcatgaccttcttactgaggccctggtcgagcag
ggagagtacaagccccgtctggccttcgggcccgtgcggatcgccgtatccggtcgccgg
gtgtcgcccccgctcttcgagtccttggagattatcggcaagaccgcaacactccagcgg
ctgaccaacttgcgccaacatctctga

DBGET integrated database retrieval system