KEGG   Bifidobacterium coryneforme: BCOR_1001Help
Entry
BCOR_1001         CDS       T03236                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bcor  Bifidobacterium coryneforme
Pathway
bcor00260  Glycine, serine and threonine metabolism
bcor01100  Metabolic pathways
bcor01110  Biosynthesis of secondary metabolites
bcor01120  Microbial metabolism in diverse environments
bcor01130  Biosynthesis of antibiotics
bcor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCOR_1001
Enzymes [BR:bcor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BCOR_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AII75011
UniProt: A0A076JK95
Position
1242936..1243961
Genome map
AA seq 341 aa AA seqDB search
MLSFVNDYSEGAHPAVLQRLIDTNMEQLPGYGRDRYCSSAARKIAEDCSCPQAQVFFMAG
GTQTNQTIVSCILKPWQGLVAADTGHVNVHEAGAIEAVDHKVLTVEGDRGKIRPDTLDSY
LEGFYADGNHEQMVFPGMVYISHPTEYGTLYTRQELEQLSDICHRYEIPLYLDGARLGYG
LVAPGTDVDLDDIAALCDIFYIGGTKVGALCGEAVVFPKGDAPEHMSTMIKRRGALLAKG
RLLGIQFDALFTDDLYKRISRNAIDTATMIKDALREKGYQIYMDSPTNQTFVRLDNRKME
ELAEHVAFDFWERSDADHTIIRFATSWATSIEDTKALIDLL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctctcattcgtcaacgactattccgaaggcgcccatcccgcagtccttcagcggctg
atcgacaccaacatggagcagctccccggatacggcagggaccggtattgcagctcggca
gcacgcaaaatagccgaagactgctcctgcccccaggcccaggtcttcttcatggcgggt
ggcacacagaccaatcagaccatcgtctcctgcatcctcaagccttggcagggccttgtc
gccgcggataccggacacgtgaacgtccacgaagcgggggccatcgaggcagtcgaccac
aaggtccttacggtcgagggagaccgggggaagattcgccctgacaccctggattcatac
cttgaagggttctacgccgacggcaaccacgagcagatggtcttccccggcatggtgtac
atatcccaccccaccgaatacggcacgctctacacccggcaggaacttgagcagctctct
gatatctgccaccggtatgagatccccctctatctggatggcgcccggttgggatacggc
ctggtggcaccggggacggatgtggacctggacgacatcgccgctctctgcgacatcttc
tatatcggtggaaccaaggtgggcgccctctgcggtgaggccgtggtcttccccaagggt
gacgcccctgagcacatgagcacgatgatcaagcggcgtggggccctcctggccaaggga
aggctgctcggcatacagtttgatgccctcttcaccgatgacctgtacaagcggataagc
cgcaatgccatcgacaccgccacgatgatcaaggatgccttgagggagaagggctatcaa
atctatatggactcccccaccaatcagaccttcgtacgcctggacaacaggaagatggag
gagctggccgagcatgtggcctttgacttctgggagcgcagcgatgccgaccacacaatc
atcaggttcgccacatcctgggccacatcaatcgaggacaccaaggccctgattgacctg
ctctga

DBGET integrated database retrieval system