KEGG   Blattabacterium Cpu (Cryptocercus punctulatus): BLBCPU_387Help
Entry
BLBCPU_387        CDS       T01660                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bcp  Blattabacterium Cpu (Cryptocercus punctulatus)
Pathway
bcp00471  D-Glutamine and D-glutamate metabolism
bcp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BLBCPU_387 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcp01011]
    BLBCPU_387 (murI)
Enzymes [BR:bcp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BLBCPU_387 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:bcp01011]
 Precursor biosynthesis
  Racemase
   BLBCPU_387 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Mg-por_mtran_C
Motif
Other DBs
NCBI-ProteinID: AEU09429
UniProt: G8LS56
Position
391648..392460
Genome map
AA seq 270 aa AA seqDB search
MRISPYSPIGIFDSGIGGILIAKEIKTYMPNECIIYFGDTKNMPYGNKSKDFIRNNSIKI
VSFLYKKKCKAIVIACNSITSNALDLIKKNFYKKILIFNVIDPIVKNKIFLSSKRIGIMA
TPATINSNFYHKKIKKCFPHLEISQISTPLLATIIENGLEKIKINSIIKYYLNNLKSIDT
LLLACTHYLFLKKKIDNFYHGKVRLIDIQKIVVQEIQKKLFENNLLCIYPKKRNNTIFYT
SSSISPFFKEQVRIHFGEKILFKKHILNFF
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagaattagcccctattctccgataggaatatttgattctggtatcggaggaattctt
atagctaaagaaattaaaacctatatgcctaatgaatgtattatttattttggagatact
aaaaatatgccttatggaaataagtctaaagactttattagaaataattctataaaaatt
gtttctttcctttataaaaaaaaatgtaaagccatagtaatagcttgtaattctataact
tctaatgctttagatttgattaaaaaaaatttttataaaaaaatattaatatttaatgtt
atagatcctatagtaaaaaataaaatatttctttcttctaaaagaataggaataatggcc
actcctgctaccataaattccaatttttatcataaaaaaattaaaaaatgttttcctcat
ttagagatttcccaaatatctacacctttattagctacaataattgaaaatggattggaa
aaaataaagattaattctatcataaaatattatttgaataatctaaaatcaatagatacg
ctattattagcttgtactcattatttatttttgaaaaaaaaaatagataatttttatcat
ggtaaagttcgtttaatagatatacaaaaaattgtagttcaggaaatacaaaaaaaatta
tttgaaaataatttattatgcatttatccaaaaaaacggaataatacaattttttataca
tctagttcaatttctccattttttaaagaacaagttcgaattcattttggagaaaaaatt
ttatttaaaaaacatattcttaattttttctaa

DBGET integrated database retrieval system