KEGG   Blattabacterium Cpu (Cryptocercus punctulatus): BLBCPU_556Help
Entry
BLBCPU_556        CDS       T01660                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcp  Blattabacterium Cpu (Cryptocercus punctulatus)
Pathway
bcp00020  Citrate cycle (TCA cycle)
bcp00310  Lysine degradation
bcp01100  Metabolic pathways
bcp01110  Biosynthesis of secondary metabolites
bcp01120  Microbial metabolism in diverse environments
bcp01130  Biosynthesis of antibiotics
bcp01200  Carbon metabolism
Module
bcp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLBCPU_556 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BLBCPU_556 (sucB)
Enzymes [BR:bcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BLBCPU_556 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AEU09591
UniProt: G8LR23
Position
complement(565234..566478)
Genome map
AA seq 414 aa AA seqDB search
MIIKVKTPSPGESITELEVTSWLVKDGDYVSKNQLIAELDSDKATLEVSAEENGIITLIG
KKGKKIKVGDILCTIDTSKKKETYEKKYKQLYPEKKIDKINKNKKKEIISDNKNWPSPAS
KKILKEKNIPIESIKGTGKNGRITKKDCIDTNTNDDINYHSFIEKKPTPIYRSTRVTPLS
SLRRKLSERLVSVKNKTAMLTTFNEVNMQEVFLIRKKYKSIFKEKHGVNLGFMSFFTISC
IRGIHIYPDINAIINGEQKINFEYCDISIAISGPKGLMVPVIRNAEHLSFRGIEQEISRL
STRVRNGKISIDEMEGGTFTITNGGIFGSMLSTPIINPPQSAILGMHKIVERPVVINKSI
EIRPIMYLSLSYDHRIIDGKEAVGFLVSVKESIENPIKFLMGKNEKNIPKILEL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgataataaaagtaaagacaccttcaccaggagaatcaattacagaattagaagttacc
tcatggctagttaaagatggagattatgtatccaaaaatcagttaatagctgaattagat
tcagataaagcaactttagaagtttctgcagaggaaaatggtataattaccttgattgga
aaaaaaggaaaaaaaataaaagttggggatattctctgtactatagatacttctaaaaaa
aaagaaacttatgagaaaaaatataaacaactatatcctgaaaaaaaaatagataagatt
aataaaaataaaaaaaaggaaataatttctgataataaaaactggccttctccagcatca
aaaaaaatattgaaagaaaaaaatattcctatagaatctattaaaggaacgggaaaaaat
ggaagaattacaaaaaaagattgtattgatactaatactaatgatgatataaattaccat
tcttttatagaaaaaaaacctactccaatatatcgttcaacaagagtgactcctctttct
tctcttagaagaaaactatctgaaagattggtttctgtaaaaaataaaacggccatgcta
actacttttaatgaagttaatatgcaggaagtttttttaataagaaaaaaatacaaaagt
atttttaaggaaaaacatggagttaatttaggatttatgtctttttttactatttcttgt
attagaggaatacatatatacccagatattaatgccataataaatggagaacaaaaaatt
aattttgaatattgtgatattagtattgctatatcaggaccaaaaggattgatggtacct
gtaattagaaatgcagaacatttatcttttcgtggtatagaacaagaaattagtagatta
tctacacgtgttcgaaatggaaaaatatctatagatgaaatggaaggaggaacttttact
attactaatggtggtatatttggatctatgctctctactccaataataaatccaccacaa
agcgctattttaggaatgcataaaatagtagaaaggccagtagttattaataaatctatc
gaaatccgtccaataatgtatttatctttatcttatgatcatagaataattgatgggaag
gaagctgttggatttttagtatctgtcaaagaatcaatagaaaatccaataaaattttta
atgggaaaaaatgaaaaaaatattcctaaaatattggagttataa

DBGET integrated database retrieval system