KEGG   Bacillus cereus Q1: BCQ_0021Help
Entry
BCQ_0021          CDS       T00852                                 

Gene name
dck
Definition
(GenBank) deoxynucleoside kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00230  Purine metabolism
bcq00240  Pyrimidine metabolism
bcq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BCQ_0021 (dck)
   00240 Pyrimidine metabolism
    BCQ_0021 (dck)
Enzymes [BR:bcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BCQ_0021 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     BCQ_0021 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Cytidylate_kin2 AAA_33 TsaE Thymidylate_kin AAA_28 AAA_29 CbiA PRK RNA_helicase AAA_25 RsgA_GTPase ParA AAA_16 ABC_tran IstB_IS21 AAA MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ACM10544
UniProt: B9IYI2
Position
complement(22464..23132)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatatcccaaatgacgcagtaatcactatcgctggaaca
gtaggtgtcggtaaatccactatgacaactgcattagctaacgctttagggtatcgcaca
tcatttgaaaaggtagattctaatccgtatttggacaagttctatgctgatttcacacgc
tggagctttcacttacaagtgtattttttagcagaacgatttaaagaacaaaaaagaatt
tttgaatacggtggcggttttgttcaagatcgctctatctatgaagacactggcattttt
gcaaaaatgcatcacgaaaaaggtacaatgacggaaactgattatgaaacatataaaggt
ttatttgacgctatggtcatgactccttacttcccacatccagatttattaatttactta
gaaggttctttcgatgatattgttgatcgtatccaagaacgtggacgtccgatggaacag
caaacaccaatcgagtattggaaagagatgcatgggcgttatgaaaactggattaacaac
ttcaattcatgccctgttttacgattaaacattaatgaatacgatattttaaaagatggc
gattccattgaaccaatcataaaaaaaatcggtcattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system