KEGG   Bacillus cereus Q1: BCQ_1304Help
Entry
BCQ_1304          CDS       T00852                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00260  Glycine, serine and threonine metabolism
bcq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01130  Biosynthesis of antibiotics
bcq01230  Biosynthesis of amino acids
Module
bcq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCQ_1304 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCQ_1304 (trpB)
Enzymes [BR:bcq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCQ_1304 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACM11734
UniProt: B9IU38
Position
1293284..1294477
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMEDEEFQKELNHYLKTYVGRET
PLYFAENMTKYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKKDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggtcactacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtattagaactagaagaagcatataaagaggcaatggaa
gatgaagagtttcaaaaggaattaaatcattatttaaaaacgtatgtcggaagagaaacg
ccgctttatttcgctgagaatatgacgaagtattgcggtggtgcaaagatttatttaaaa
cgtgaagatttgaaccatacaggagctcataaaattaataatacaatcggtcaggcactt
cttgcggtgcgaatgggcaagaaaaaagttgtcgctgaaacaggagctggacaacacgga
gttgcaacagctactgtatgtgcccttctcggtttagaatgcgtcatttttatgggagaa
gaagatgtaagacgtcaaaaattaaatgtgttccgaatggaattactcggagcgaaagta
gaaagtgtagcagcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgctac
tgggtttcacatgtgcatgatacgcactacattatgggatctgttctcggaccacatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattggaaatgaaacgaaaaaacaatat
gaagcattagaaggaaagttaccagaagcagtcgttgcttgtattggcggtggtagtaat
gcgatgggtatgttttatccgttcgtacacgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggagttcatacagaaaagcatgcagctactttaacgaaaggaagcgtt
ggcgttctccacggatcgatgatgtatcttctgcaaaatgaagaaggacaaattcaagaa
gctcactctatttcggcgggacttgattaccctggtgttgggccagaacatagcttgcta
aaagatattggccgcgtttcttatcattccattactgatgatgaagcgttagaagcattt
caattattaacgaaaaaagaaggaattatcccggcgttagaaagctcgcatgctgtcgcg
tacgctttaaaattagcgccgcaaatgaagaaagacgaagggcttgtcatttgtttatct
ggccgcggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system