KEGG   Bacillus cereus Q1: BCQ_1453Help
Entry
BCQ_1453          CDS       T00852                                 

Gene name
aph
Definition
(GenBank) possible aminoglycoside phophotransferase
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
bcq  Bacillus cereus Q1
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bcq01504]
    BCQ_1453 (aph)
Enzymes [BR:bcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     BCQ_1453 (aph)
Antimicrobial resistance genes [BR:bcq01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    BCQ_1453 (aph)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase Pkinase
Motif
Other DBs
NCBI-ProteinID: ACM11881
UniProt: B9IUX0
Position
complement(1431217..1432119)
Genome map
AA seq 300 aa AA seqDB search
MDSYKQYIKEALPNLSIHSYKQNEEGWDNVAIIVNDELLFRFPRKQEYAMRIPLEKELCT
ILTQSLQEIEVPQYHLIYTNESDEVPLCSYYTLIHGEPLKTEIVANLDEKERKIIITQLA
TFLAALHSIPLKSVTALGFPTEKTLTYWKELQTKLNEYVTNSLTSFQKSTLNRLFENFFA
CLATSKFQNTIIHADFTHHHILFDKQNKTISGIIDFGDAQIGDPAFDFAGLYDDFGHEFT
TSVYEQYCTLTSHHDPLLIHRITSFYQYSPLLHNIIYNFETKNELEFLASIEQLKVILQG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggactcttacaaacaatatataaaagaagctttgcctaatctttctatacattcctat
aaacaaaatgaagaaggatgggataatgtagcgattatagtaaatgatgagctactgttt
cgtttcccgcgaaaacaggaatatgcaatgcgaattccgttagaaaaagaactgtgcaca
attctcactcaatcactacaagaaatcgaagttccacaatatcacctaatttatacaaat
gaatctgatgaggttcctctttgtagctactatactctcattcatggtgaaccgttaaaa
acagaaatagttgcgaacttagatgaaaaagaacgaaaaataattattacacaattagct
actttccttgcggctctacatagcattcctctaaaaagtgttacagcgttagggttccct
accgaaaaaacacttacctactggaaagagctacaaactaaattaaatgagtatgttact
aacagtctaacttcgttccagaaatcaaccttaaaccgtttattcgagaatttctttgcc
tgtctagctacatccaaatttcaaaatacaatcattcacgctgattttacacatcatcac
attttatttgataaacaaaataaaaccatttcaggaatcattgattttggtgatgctcaa
attggagatcctgcctttgactttgctgggctatatgatgatttcggacatgaatttact
acatcagtatatgaacaatactgtacacttacttcacaccatgatccattactcattcac
cgcatcacgagtttttatcaatacagtcctttactacataatataatttataactttgaa
acaaagaatgaacttgaatttctagcaagtatagaacaactgaaagtaatactacaggga
tga

DBGET integrated database retrieval system