KEGG   Bacillus cereus Q1: BCQ_1855Help
Entry
BCQ_1855          CDS       T00852                                 

Gene name
ilvA
Definition
(GenBank) threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00260  Glycine, serine and threonine metabolism
bcq00290  Valine, leucine and isoleucine biosynthesis
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01130  Biosynthesis of antibiotics
bcq01200  Carbon metabolism
bcq01230  Biosynthesis of amino acids
Module
bcq_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCQ_1855 (ilvA)
   00290 Valine, leucine and isoleucine biosynthesis
    BCQ_1855 (ilvA)
Enzymes [BR:bcq01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     BCQ_1855 (ilvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_dehydrat_C
Motif
Other DBs
NCBI-ProteinID: ACM12283
UniProt: B9IX73
Position
1830978..1832180
Genome map
AA seq 400 aa AA seqDB search
MKDIVIKTPLQRDTVLSEKYDCDVYVKREDLQLIRSFKIRGAYNLIQSLPKVQLQNGVVC
ASAGNHAQGVAYTCNLLKIPSKIFMPTTTPKQKVSQVQFFGGDFAEIVLVGDTFDSSFQE
AQRYCEENRMTFVHPFDDPYVVAGQGTVAVEIMHDMEKPVDYIFTAIGGGGLASGVGTYV
KGVSPATQVIGVEPMGAASMKEAFLQNDNVALEKIDSFVDGAAVKKVGKLTFETCKDVID
DIVLVPEGKVCTTILELYKKNAIVAEPAGALSIAALDLYRDEIKGKTVVCTLSGGNNDID
RMQEMKERSLIYEGLKHYFIIEFPQRSGALREFLDKGLGPEDDITRFEYIKKHNKENGPA
LVGVELKHKEDYEQLITRFKENNIQFMELNKNPVLFDLLI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatatcgttattaaaacaccgttacaacgtgatacagttttatctgagaaatat
gattgtgacgtttatgtaaaacgagaagacttacaattaattcgctctttcaaaattcgt
ggtgcgtataatctaattcaaagtttaccgaaagtacaattacaaaacggtgttgtttgt
gcaagtgctggtaatcatgcgcaaggagtagcttatacgtgtaatttattgaagattccg
tcaaaaattttcatgccgacgacgacacctaaacaaaaagtgtcacaagtacaatttttc
ggtggtgattttgcggaaattgtattagttggtgatacatttgatagctctttccaagaa
gcacagcgttattgtgaagaaaatagaatgacatttgttcatccgtttgatgatccgtac
gtagttgctggtcaagggacagtggcagttgaaattatgcatgatatggagaaaccggtt
gattatatctttacagcaattggtggtggtggattagcatcaggtgttggtacatatgtg
aaaggtgttagtcctgctacacaggtcattggggtagagccaatgggagctgcatctatg
aaagaggcttttcttcaaaatgataatgtcgcattggagaaaatagatagttttgttgat
ggggcagcggttaaaaaggtaggaaagttaacatttgaaacttgtaaagatgtaattgat
gacattgttttagtaccagaaggaaaggtttgtacgacgattttagaactgtataagaaa
aatgcgattgtagctgaaccagctggtgcactctctattgcagcgcttgatttatacaga
gatgaaataaaaggtaaaacagttgtttgtacgctaagtggtggaaataatgatattgat
agaatgcaagaaatgaaagaacgatctctcatttatgaaggattaaagcattatttcatc
attgaattcccacagcgttcaggtgcgttaagagaatttcttgataaaggattagggcca
gaagatgatattactcgctttgagtatattaagaaacataataaagaaaatggtccagca
ttagtcggagtagagttaaaacataaagaagattatgagcaattaattactcgttttaaa
gaaaataatattcaatttatggagcttaataaaaatcctgttttgtttgatttgcttatt
taa

DBGET integrated database retrieval system