KEGG   Bacillus cereus Q1: BCQ_1993Help
Entry
BCQ_1993          CDS       T00852                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00520  Amino sugar and nucleotide sugar metabolism
bcq01100  Metabolic pathways
bcq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BCQ_1993 (nagA)
Enzymes [BR:bcq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BCQ_1993 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ACM12421
UniProt: B9IXZ5
Position
1972442..1973590
Genome map
AA seq 382 aa AA seqDB search
MSIFIFADKFFLEGKVVGPGFLEIKDGKFGIFLENRPEEVEEIIDYAGYWIAPGLVDTHI
HGFRNHDVMDNNFEGLNQISVGLLSCGVTSFLPTTLTSSIESLNNVVEMIGANYKKVQGA
KIKGIFLEGPFFTEKHKGAQNTKYFCDPSVDMLKGWQKLSNDSIKKIAIAPERKGAAEFI
EYAVGEEIIVALAHSDATYEEAKQASEKGASVFVHTFNGMSPLHHREPGMVGAAMNLKDV
FTEIICDGHHVHPVALNILMNVRGREEVVMVSDCMMAGGMTEGTYQLGEFPVKVKGGMAC
LESGSLAGSILQLKDAVKNVVDWGIAAPEQAIYMASTAPAKSIQLDGECGKIAEGYAADF
IVLTPAMDLAATYLDGVCRFQA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttttatctttgcagataagttttttcttgaggggaaggtcgtaggtcctggt
tttttggagataaaagatggaaaattcggtatctttttagagaacaggccagaagaagtg
gaagaaatcattgattatgcaggatattggattgctcctggtctagtggatacacatatt
catggttttagaaatcacgacgttatggacaataattttgaaggactaaatcaaatatcg
gtaggactcctttcttgcggcgttacatcctttttaccgacaactttaacatcctcaata
gaatcgttgaataatgtcgttgaaatgattggtgccaattacaagaaagtacagggcgca
aaaattaaagggatctttttagaagggccgttttttactgaaaagcataaaggagcacaa
aacacgaaatatttttgtgacccatcagttgatatgttgaaaggttggcagaaattatca
aatgattctattaaaaaaattgcgattgcacctgaaagaaaaggagcagcggaattcatt
gaatatgctgtaggagaagagattatagtagcattggcccatagtgatgcaacttatgaa
gaagccaagcaagctagtgaaaaaggcgcatccgtttttgttcatactttcaatggtatg
agtccgctgcaccatcgtgagccagggatggttggagcagccatgaatttaaaagatgtt
tttaccgaaatcatatgtgatggacatcatgttcatcctgttgctttaaatattttaatg
aatgtccgtggcagagaagaggttgtaatggtatccgattgtatgatggccggaggtatg
actgaaggaacgtatcaacttggagaatttcctgtgaaagtaaaaggtgggatggcttgt
ttggaaagcggaagtttagcaggtagcattttgcaattaaaagatgctgtcaaaaatgtc
gtcgattggggaattgccgcgcccgagcaagcaatttacatggcgagtactgcaccagct
aaaagtattcaactagatggcgaatgtgggaaaatcgctgaggggtatgctgctgacttt
atagtactgacgccagcgatggatttagcagctacctatcttgatggtgtgtgccgtttt
caagcttaa

DBGET integrated database retrieval system