KEGG   Bacillus cereus Q1: BCQ_2406Help
Entry
BCQ_2406          CDS       T00852                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00010  Glycolysis / Gluconeogenesis
bcq00260  Glycine, serine and threonine metabolism
bcq00680  Methane metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01200  Carbon metabolism
bcq01230  Biosynthesis of amino acids
Module
bcq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcq_M00002  Glycolysis, core module involving three-carbon compounds
bcq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_2406 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BCQ_2406 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCQ_2406 (gpm)
Enzymes [BR:bcq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BCQ_2406 (gpm)
Membrane trafficking [BR:bcq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BCQ_2406 (gpm)
Exosome [BR:bcq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BCQ_2406 (gpm)
  Exosomal proteins of melanoma cells
   BCQ_2406 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACM12834
UniProt: B9J102
Position
2369232..2369969
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSEKGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLAWVPVHKCWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSIDVR
PPALTEDDPRYEMNDPRYKALKKGEFPLTECLVDTEKRVLAYWHSEIAPKLKNGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHITF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacagagtttatggaatcttgaaaatcgcttt
actggatggacagatgtagatttatcagagaaaggattaagtgaagcgagagaagcagga
gcgatattaaagaaaaacggatatacttttgatgtagcttatacatctgtattaaaacga
gcaattcggacgttatggattgtacttcatgagatggatcttgcctgggtgccagtacat
aaatgttggaagctaaatgaaagacattatggtgcattgcaagggttgaataaagatgaa
accgcgcaaaaatatggtgaggagcaagttcatatttggagaagaagtattgatgtaaga
ccacctgctcttactgaggatgatcccaggtatgaaatgaatgatccaagatataaagca
ctgaaaaaaggtgagtttccattgacagaatgtttagtggatacggagaaaagagtactt
gcttattggcattcagaaattgcgccgaaattaaagaatggtaacaaagtaatcatttca
tcacatggtaacacaattcgctcgctagtaaaatatttagataatctttcaagcgatggt
gtcgtttcattaaatattccaacgagcataccactcgtgtatgaattagacgaaaattta
cgtccgattcgccattattacttaagtatggatggagaagtacctgaaggagaaattccg
aaacatattactttttaa

DBGET integrated database retrieval system