KEGG   Bacillus cereus Q1: BCQ_2472Help
Entry
BCQ_2472          CDS       T00852                                 

Definition
(GenBank) acetamidase/formamidase family protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00330  Arginine and proline metabolism
bcq00360  Phenylalanine metabolism
bcq00380  Tryptophan metabolism
bcq00627  Aminobenzoate degradation
bcq00643  Styrene degradation
bcq01100  Metabolic pathways
bcq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BCQ_2472
   00360 Phenylalanine metabolism
    BCQ_2472
   00380 Tryptophan metabolism
    BCQ_2472
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BCQ_2472
   00643 Styrene degradation
    BCQ_2472
Enzymes [BR:bcq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BCQ_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FmdA_AmdA Ribosomal_S7
Motif
Other DBs
NCBI-ProteinID: ACM12900
UniProt: B9J1W4
Position
2433433..2434347
Genome map
AA seq 304 aa AA seqDB search
MYRIQKEHIIYAMSPENKPCMEVEIGSRLIFETYDCFENQIDSEDVVFQELDWNRINPAT
GPVYINGAEPGDILVVTIEKIKIAEKGVLTTGANLGVMGEELHENTVKIVSVHNEHVLFS
NELQIPINPMIGVIGTAPKEESISCGTPHDHGGNMDCKEIKEGTTLLLPVNVPGALLALG
DLHAAMGDGEIGVNGVEVAGEVTVTVQIIKGKKWPLPMAIQKEKIMTLASEKLLDDAANR
AVRNMVTFLHEELEMSKADATLLLSAAGDLKVCQVVDPLKTARMELEMNYVEKLGFTMSE
FHIK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgaattcagaaagaacatatcatttacgcaatgtcaccagaaaataaaccatgt
atggaagtggaaattgggagtcgccttatatttgaaacatatgattgctttgaaaatcaa
attgattctgaagatgttgtgtttcaagagttagattggaaccggattaatccagcgact
ggtccggtatatattaatggtgcagaacctggtgatatattagttgttacgattgaaaag
ataaaaattgcagagaaaggcgttttaactacaggtgcaaatcttggtgtaatgggtgaa
gagctacatgaaaatacagtgaaaattgtctcagtacataatgaacatgttttgttttca
aatgaactacaaatcccgattaatccaatgatcggtgtaattggtactgcgccgaaagaa
gagagcatttcatgtggcacaccgcatgatcacggtgggaatatggattgtaaagagata
aaagaagggacaacattattattacctgtaaatgttcctggtgctctattagcattaggt
gatttacacgcagcgatgggcgatggtgaaattggggttaatggagtagaggttgctggt
gaggtgacggtaacagttcagattataaaaggaaagaaatggccattaccaatggctatt
caaaaagaaaaaataatgacgcttgcttcagagaaattgttagatgatgcagcgaatcgt
gctgtacgtaatatggtgacatttttacatgaagaattagaaatgtctaaagctgatgcc
acgcttttattatcagctgccggtgatttaaaagtttgtcaagtggttgacccgctgaag
actgctcgaatggaattagagatgaattatgtggagaaattggggtttactatgagtgaa
ttccatattaaataa

DBGET integrated database retrieval system