KEGG   Bacillus cereus Q1: BCQ_3303Help
Entry
BCQ_3303          CDS       T00852                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00010  Glycolysis / Gluconeogenesis
bcq00071  Fatty acid degradation
bcq00350  Tyrosine metabolism
bcq00625  Chloroalkane and chloroalkene degradation
bcq00626  Naphthalene degradation
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_3303
  Lipid metabolism
   00071 Fatty acid degradation
    BCQ_3303
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCQ_3303
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCQ_3303
   00626 Naphthalene degradation
    BCQ_3303
Enzymes [BR:bcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCQ_3303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N AlaDh_PNT_C ELFV_dehydrog DUF1687 YjeF_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ACM13731
UniProt: B9ITN7
Position
3246148..3247146
Genome map
AA seq 332 aa AA seqDB search
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPL
ILGNDFAGVIIKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEE
AASIPLVGLTSYQALHDIMQLQKNQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGA
NLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGSIVSVSGMPNA
RFGKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRTIANYIEAGKIKP
VIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgataattgataagtacggaaaagtcccaatgcgtatggccgaggtacct
attcctgaaataaatgagcatgaagtgctcgcagaaattcatgcagctagtattaaccca
attgattttaaaatacgcgatggaaaagtaaagatgttacttaaatatgaaatgccccta
atccttgggaatgactttgctggtgtcatcataaaggttggatcaaaagtaactcgtttt
aaagtcggcgatgaaatatatgcacgtccaagaaaaaataagattggtacttttgcggag
tatatagccattcatgaagatgacatagctttaaaaccgaaaaatttaagttttgaagaa
gctgcttcaattccacttgttggcttaacatcatatcaagcattacatgacattatgcaa
ttacaaaaaaatcaaaagattttaattcacgctggatctggtggtgttggtactttcgca
attcagttagcaaaaataatgggtgctaccgttacaacaactgctagtgaggctggtgca
aatttagtaaagtctcttggcgcagatcaaattattaattataaaacagaaaaatttgaa
gaaatactaaaagattatgatgcagtatttgataccattggtggtacaacacttgaaaaa
tcattcgatattataaaaagcggcggcagcattgtttctgtttcaggaatgccaaatgct
cgtttcggtaaagaattcggttctggattttttaaaacattcttattttcattagcaagt
aaaaaacttactgcacttgaaaaaaagcataatgctcaatattcatttttatttatgaag
ccaagcggagatcaattacgtactatcgcaaactatattgaagccggaaaaatcaaacct
gtaatcgatcgagttttcccttttgaagatgctcaaaaagcaatggaatattcagaggct
ggaagagcaaaggggaaaataattgtaaaaatgaaataa

DBGET integrated database retrieval system