KEGG   Bacillus cereus Q1: BCQ_3506Help
Entry
BCQ_3506          CDS       T00852                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bcq  Bacillus cereus Q1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-ProteinID: ACM13934
UniProt: B9IUM4
Position
3456852..3458183
Genome map
AA seq 443 aa AA seqDB search
MSHYNDSQNKFSKPCFPSSAGRIPNTPSIPVTKAQLRTFRAIIIDLTKIIPKLFANPSPQ
NIEDLIDTLNLLSKFICSLDATSSLKAQGLAIIKNLITILKNPTFVASAVFIELQNLINY
LLSITKLFRIDPCTLQELLKLIAALQTALVNSASFIQGPTGPTGPAGATGATGATGPRGN
TGATGATGPQGNTGATGATGPRGNTGATGATGPQGNTGATGATGPQGNTGATGATGPQGN
TGATGATGPQGNTGATGATGPRGNTGATGATGPQGNTGATGATGATGPQGPQGPAGATGA
TGPQGVQGNTGATGATGPQGVQGNTGATGATGPQGVQGNTGATGATGPQGVQGNTGATGA
TGPQGVQGNTGATGATGPQGVQGNTGATGATGPQGVQGNTGATGATGPQGVQGNTGATGA
TGPQGVQGSGGCYRRYWTSRRSR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtctcattataacgacagtcagaacaaattctccaaaccatgctttccaagtagcgct
ggacgaattccaaatactccatcaatcccagttactaaggcacaacttagaacattccgc
gcaatcattatcgatttaacaaaaataatcccaaaacttttcgcaaatccatctccccaa
aatattgaagatctaattgatacattgaacctactaagtaaatttatttgttcactagat
gctacttcctccctgaaagcacaagggttagctattattaaaaacttaataactatatta
aaaaatccaactttcgtagcaagcgctgtatttatcgagcttcaaaatctaattaactat
ttactatccattacaaaactattccgaattgacccttgcacacttcaagagcttcttaaa
ttaatcgcagcattacaaaccgctctagttaattctgcttcattcattcaaggacctact
ggacctactgggccagcaggggctaccggtgctactggcgctaccggacctcggggtaat
acgggggctactggtgctactggacctcaaggtaatacgggggctactggtgctaccgga
cctcgaggtaacacgggcgctactggtgccactggacctcaaggtaacacgggcgctact
ggtgccactggacctcaaggtaacacgggcgctactggcgccactggacctcaaggtaac
acaggcgctactggtgctactggacctcaaggtaacacgggcgctactggtgctaccgga
cctcgaggtaacacgggcgctactggcgccactggacctcaaggtaacacaggcgctact
ggtgctaccggcgctactggacctcaaggacctcaagggccggcgggtgctactggtgcc
actggacctcaaggcgttcaaggtaatacaggtgctactggtgccactggacctcaaggc
gttcaaggtaatacaggtgctactggtgccactggacctcaaggcgttcaaggtaataca
ggtgctactggtgccactggacctcaaggcgttcaaggtaatacaggtgctactggtgcc
actggacctcaaggcgttcaaggtaatacaggtgctactggtgccactggacctcaaggc
gttcaaggtaatacaggtgctactggtgccactggacctcaaggcgttcaaggtaataca
ggtgctactggtgccactggacctcaaggcgttcaaggtaatacaggtgctactggtgcc
actggacctcaaggcgttcaagggtccggcgggtgctaccggcgctactggacctcaagg
cgttcaaggtaa

DBGET integrated database retrieval system