KEGG   Bacillus cereus Q1: BCQ_3606Help
Entry
BCQ_3606          CDS       T00852                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00900  Terpenoid backbone biosynthesis
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01130  Biosynthesis of antibiotics
Module
bcq_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCQ_3606 (dxr)
Enzymes [BR:bcq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BCQ_3606 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACM14034
UniProt: B9IVB0
Position
complement(3568905..3570047)
Genome map
AA seq 380 aa AA seqDB search
MKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSAGKNIDYAVKVIQEFSPQIVSVQREE
DVLKLQAVSGNTKVVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIGIAN
KETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFRDKT
RDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLHKES
IIHSMVEFEDRSVMAQLGSPDMRVPIQYALTYPDRLPLSDTKQLNLWEMGTLHFEKMNQE
RFRCLRFAYEAGKTGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMNHHNVIARP
SLEEILEIDAATRRFVMEQI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattagtttattaggtgcaagcggatcaattggtacacaaactttagatgta
ttacgctcgcacccagaccaattccgtctcgttgctttttctgcagggaaaaatattgac
tacgcagtaaaagtcattcaagaattttctccgcaaattgtctctgtgcaaagagaggaa
gatgttttaaaattacaagctgtctctggtaatacaaaagttgtatatggtagtgaagga
cttttagaagtagcattacatccagatgcggagatcgtagtaaatgctgttgtaggtagc
gtagggttgttaccaacacttcgtgcaattgaggcgaaaaaaacaattggaattgcaaac
aaagaaacgttagtaactgcagggcatcttgtaatggaagcagcgcgaaaacataatgtt
tcgttacttccagtagacagtgaacattcagctatttttcaatgcttgaatggtgaaaat
gaaaaaagaatttctcgactaattataacggcttctggtggaagtttccgtgataaaacg
agagatgaattgcatcatgtgaccgtagaagatgcgcttcgacatccaaactggtcaatg
ggttcgaaaattacaattgattctgctacaatgatgaataaggggctagaagtaattgaa
gcacattggctttttggtatcccttacgagcaaatcgatgttgttttacataaagaaagt
attattcattctatggttgaatttgaagatcgtagtgtgatggcacagcttggctcacct
gatatgcgagtgccaattcaatacgcacttacatatcctgatcgattacctctttcagac
acaaagcagttaaatttatgggaaatgggtacattgcattttgagaaaatgaatcaagaa
cgtttccgttgcttgcgctttgcgtatgaagctggaaaaacaggtggaagtatgccagct
gtaatgaatgcagcgaatgaagtagctgttgaagcttttttacaaaagagaattggtttc
ttgacagtggaagacctcattgaaaaagcaatgaaccatcacaatgtcattgcacgtcca
agcttagaggaaattctggaaattgatgcagccacaagacggtttgtgatggaacaaatt
tag

DBGET integrated database retrieval system