KEGG   Bacillus cereus Q1: BCQ_4048Help
Entry
BCQ_4048          CDS       T00852                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00010  Glycolysis / Gluconeogenesis
bcq00052  Galactose metabolism
bcq00500  Starch and sucrose metabolism
bcq00520  Amino sugar and nucleotide sugar metabolism
bcq00521  Streptomycin biosynthesis
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01200  Carbon metabolism
Module
bcq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_4048 (glcK)
   00052 Galactose metabolism
    BCQ_4048 (glcK)
   00500 Starch and sucrose metabolism
    BCQ_4048 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BCQ_4048 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCQ_4048 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BCQ_4048 (glcK)
Enzymes [BR:bcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCQ_4048 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: ACM14476
UniProt: B9IXQ5
Position
complement(3968370..3969353)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETDKESILRSMLAEEGRITSKDVFEAHGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtatacggtgaaattttacataagtgggaaatccctacgaatacaaatgagcaa
ggaaaacatattacacttgatgtagcgaaagctattgataaaaagttagaagagttaggc
gaattaaaaagtaagttaatcggtattggtatgggagctcctggccctgtacacgtggcg
tctggaatgatttatgaagcggttaacttaggatggaagaactatccgttaaaagattta
ttagaagtagaaacaggattacctgttgtgattgataatgatgcgaacttagcagcgctt
ggtgaaatgtggaaaggtgctggtgaaggagcaaaagatttaatttgtatgacgcttggc
actggtgttggcggcggtgtaattgccaatggagagattgtacacggcgtaagcggtgct
gctggtgaaatcggacacattacagtcgttacagagaatgctttcccatgtaattgcggg
aagtctggttgcctagaaactgtagcatctgcaacaggtattgtgcgtgttgctatgcaa
aaaatacaagagactgataaagaaagtattttacgttctatgttagcagaagaaggacgt
atcacatcaaaagacgtatttgaagcacatggacaaggtgatgaactagcaggcgaagta
gtagaaaaggtagcttcttatttaggattagctgtagcgaacctttctagcacgttgaac
ccagagaaaatcgttattggcggaggcgtttctaaagctggagatgcacttttagaacca
attcaacgctattttgagcaatatgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system