KEGG   Bacillus cereus Q1: BCQ_4780Help
Entry
BCQ_4780          CDS       T00852                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00010  Glycolysis / Gluconeogenesis
bcq00030  Pentose phosphate pathway
bcq00051  Fructose and mannose metabolism
bcq00680  Methane metabolism
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01200  Carbon metabolism
Module
bcq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCQ_4780 (fbp)
   00030 Pentose phosphate pathway
    BCQ_4780 (fbp)
   00051 Fructose and mannose metabolism
    BCQ_4780 (fbp)
  09102 Energy metabolism
   00680 Methane metabolism
    BCQ_4780 (fbp)
Enzymes [BR:bcq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BCQ_4780 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ACM15181
UniProt: B9J3G2
Position
4653010..4653981
Genome map
AA seq 323 aa AA seqDB search
MERELALEIVRVTEAAALASAQWMGRGKKNEADDAATTAMRDMFDSVNMAGTVVIGEGEL
DEAPMLYIGEELGTGNGPEVDIAVDPLEGTNIVAKGLANAMAVIAIADKGNLLHAPDMYM
EKIAVGPKAAGKISLDDPIEKTIEIVAEANNKKIRDLTVIVQERERHQDIIDRVRAKGAR
VKLFGDGDVGASIATALPGTGIDLFVGIGGAPEGVISAAALKCLEGEMQARLVPMNEEEE
ARCREMGLEDPRQLLMLEDLVSGDDAIFSATGVSAGELLDGVKFLGGDLAETYSIVMRYK
TRTVRFIKTHHHLDHKPHLNLDI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
ttggaacgtgaactcgcactagaaattgtccgtgtaacagaagcagcagcattagcatcc
gcacagtggatgggccgcggaaagaaaaatgaagcagatgatgcagcaactacagcaatg
cgtgatatgttcgattcagtaaacatggcaggtacagttgtaattggtgaaggagaactt
gatgaagcaccgatgttatatattggtgaagaactaggaacaggtaacggtccagaagta
gatatcgccgttgacccattagaaggtacaaacatcgttgcaaaaggtcttgcaaatgca
atggcagttatcgcaatcgcagataaaggaaaccttcttcatgctcctgatatgtacatg
gaaaaaatcgcggttggtccaaaagcagctggtaaaattagcttagatgatccaattgaa
aaaacaattgaaattgtagcggaagctaacaataaaaagattcgcgatctaacagttatc
gttcaagaacgtgaacgtcatcaagatattatcgatcgtgttcgtgcaaaaggtgcacgc
gtaaaattatttggtgacggtgatgttggtgcgtcaatcgcaacagcactacctggaact
ggtatcgacttattcgtaggtattggcggagctccagaaggcgttatttctgcagcagca
ttaaaatgccttgaaggtgaaatgcaagctcgcttagttccaatgaacgaagaagaagaa
gctcgttgtcgtgaaatgggattagaagaccctcgtcaacttctaatgctagaagactta
gtgtctggtgatgatgcaatcttctcagcaactggtgtatctgctggtgagttattagac
ggcgtgaaattcctaggcggagatttagctgaaacatactctatcgtaatgcgttacaaa
acaagaacggtacgattcattaaaacgcatcaccatttagatcataagccacacttaaac
ttagatatttaa

DBGET integrated database retrieval system