KEGG   Bacillus cereus Q1: BCQ_5185Help
Entry
BCQ_5185          CDS       T00852                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase (acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00071  Fatty acid degradation
bcq00072  Synthesis and degradation of ketone bodies
bcq00280  Valine, leucine and isoleucine degradation
bcq00310  Lysine degradation
bcq00362  Benzoate degradation
bcq00380  Tryptophan metabolism
bcq00620  Pyruvate metabolism
bcq00630  Glyoxylate and dicarboxylate metabolism
bcq00640  Propanoate metabolism
bcq00650  Butanoate metabolism
bcq00900  Terpenoid backbone biosynthesis
bcq01100  Metabolic pathways
bcq01110  Biosynthesis of secondary metabolites
bcq01120  Microbial metabolism in diverse environments
bcq01130  Biosynthesis of antibiotics
bcq01200  Carbon metabolism
bcq01212  Fatty acid metabolism
bcq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCQ_5185 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    BCQ_5185 (atoB)
   00640 Propanoate metabolism
    BCQ_5185 (atoB)
   00650 Butanoate metabolism
    BCQ_5185 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCQ_5185 (atoB)
   00072 Synthesis and degradation of ketone bodies
    BCQ_5185 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCQ_5185 (atoB)
   00310 Lysine degradation
    BCQ_5185 (atoB)
   00380 Tryptophan metabolism
    BCQ_5185 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCQ_5185 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCQ_5185 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCQ_5185 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcq04147]
    BCQ_5185 (atoB)
Enzymes [BR:bcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCQ_5185 (atoB)
Exosome [BR:bcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCQ_5185 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACM15585
UniProt: B9IRX7
Position
complement(5050263..5051444)
Genome map
AA seq 393 aa AA seqDB search
MSKTVILSAARTPVGKFGGSLKDVKATELGGIAIKAALERANVSASDVEEVIFGTVIQGG
QGQIPSRQAARAAGIPWEVQTETVNKVCASGLRAVTLADQIIRTGDQSLIVAGGMESMSN
SPYILRGARWGYRMGNNEVVDLNVADGLTCAFSGIHMGVYGGEVAKEDGISREAQDEWAY
RSHQRAVSAHNEGRFEEEIVPVTIPQRKGDPIVVAKDEAPRADTTIEKLAKLKPVFDKTA
TVTAGNAPGLNDGGAALVLMSEDRAKQEGRKPLATILAHTAIAVESKDFPRTPGYAINAL
LEKTGKTIEDIDLFEINEAFAAVAIASTEIAGIDPEKLNVNGGAVAMGHPIGASGARIIV
TLIHALKQRGGGIGIASICSGGGQGDAVMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacagttattttaagtgctgcaagaacaccagttggaaaatttggaggatct
ttaaaagatgtaaaagcaacagaacttggagggattgcaattaaagcggcgcttgaaaga
gcaaatgtttctgctagtgatgttgaggaagttatattcggaacggttattcaaggtggg
caggggcaaattccatcgcgccaagcggcgagggctgctggaatcccttgggaagtgcag
acggaaacagtgaataaagtttgtgcatcggggcttcgtgcggttacgttagcggatcaa
attattcgtactggcgatcaatcattgattgtagctggtggtatggagtcgatgagtaac
agtccttacattttacgaggagcaagatggggatatagaatgggcaacaacgaagtcgtt
gatttaaacgttgctgacggtttaacatgcgcattttcaggtatacacatgggtgtttat
ggcggagaagttgcgaaggaagatggaatttctcgcgaagcgcaagatgaatgggcatat
cgtagccaccagcgtgcggtttcagcacataatgaaggacgttttgaagaggaaatcgtg
ccagtaacgattccgcaaagaaaaggcgatcctattgtcgttgcaaaggatgaggcgcca
cgcgcggatacaacaattgaaaagttagcaaaattaaaacctgtatttgataaaacagcg
acagtgacagctggtaatgcaccaggcttaaacgatggtggtgctgcacttgtattaatg
agcgaagacagagcgaagcaagaaggaagaaagccgttagcgacaattttggcacataca
gcaattgcagtggagtctaaagatttcccgagaacgccaggttatgcaattaacgcattg
cttgaaaaaacaggtaagacaattgaagacatcgatttattcgagattaatgaagcattt
gcagcagtagcaattgcaagtacagaaatcgcaggaattgacccagaaaaattgaatgta
aatggcggcgcagtagcgatgggacatccgattggagcaagcggagcgcgcattatcgtt
acactaatccatgcacttaagcaacgcggcggtggaattggaattgcttcgatttgtagt
ggtggcggtcaaggcgatgcagtgatgattgaagttcactaa

DBGET integrated database retrieval system