KEGG   Bacillus cereus Q1: BCQ_5249Help
Entry
BCQ_5249          CDS       T00852                                 

Definition
(GenBank) hydrolase, haloacid dehalogenase-like family
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bcq  Bacillus cereus Q1
Pathway
bcq00361  Chlorocyclohexane and chlorobenzene degradation
bcq00625  Chloroalkane and chloroalkene degradation
bcq01100  Metabolic pathways
bcq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCQ_5249
   00361 Chlorocyclohexane and chlorobenzene degradation
    BCQ_5249
Enzymes [BR:bcq01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BCQ_5249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6 Put_Phosphatase
Motif
Other DBs
NCBI-ProteinID: ACM15649
UniProt: B9ISW1
Position
complement(5121276..5121971)
Genome map
AA seq 231 aa AA seqDB search
MKKYKTLLFDVDDTLLDFQKAEKSALRMLFEEKGMSLTSEIEAQYKKINKSLWTAFEEGK
INRDEVVNTRFSILFKEYGEEVDGILFENNYRSYLEEGNQLMEGALQFINQIQSEYDLYI
VTNGISKTQDKRLRNAGLHALFQDIFVSEDTGYQKPMKEYFDYVFERIPNFVPEEGLIIG
DSLSADMKGGYVAGIDTCWFNPERKLNDSGIIPTYEVHNFEELYALLKQHV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataaaacattattattcgatgtagatgatacattgttggattttcaaaag
gcagaaaaatcggcattacgtatgctttttgaagagaaagggatgtctctcactagcgag
attgaagcgcaatataaaaaaattaataaaagtctttggactgcttttgaagaaggtaaa
ataaatcgtgatgaagttgtaaatacacgattttcaattttgtttaaagaatacggggaa
gaagtagatgggatattattcgaaaataattatcgcagttacttagaagaaggaaatcag
ctcatggaaggtgccttacaatttataaatcaaattcaaagtgagtacgatttatatata
gtgacaaacggtatttctaagacgcaagataaacgattacgtaatgcagggttacatgcc
ttgtttcaagatattttcgtttctgaagatacaggttatcaaaagccgatgaaagagtat
tttgattatgtttttgaaaggattcctaactttgttcctgaagaagggctcattattggg
gattcattaagcgctgatatgaaaggtggatatgtagcgggaattgatacttgttggttt
aatccagaaaggaaattaaatgatagtgggattataccgacatatgaagtgcataatttt
gaggagttatatgcattattgaagcaacatgtgtaa

DBGET integrated database retrieval system