KEGG   Bacillus cereus AH187: BCAH187_A1010Help
Entry
BCAH187_A1010     CDS       T00799                                 

Definition
(GenBank) alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BCAH187_A1010
Enzymes [BR:bcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BCAH187_A1010
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BCAH187_A1010
    1.1.1.-  
     BCAH187_A1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc Cas_csx3 AlaDh_PNT_C MTH865
Motif
Other DBs
NCBI-ProteinID: ACJ82417
UniProt: B7HXJ3
Position
937438..938460
Genome map
AA seq 340 aa AA seqDB search
MKAAVWYGEKDIRIEERETKELQPNDVKVKVAWAGICGSDLHAYLHPDSVPMNKNMVIGH
EFSGEIAEVGSLVTKFKEGDRVCIYPMMLKDPSNAETERFITLDAVGAQIDGGFAEYVIL
PQKTIFKIPDNLSLEVAAMVEPAAVSFQSIKDSNVGEGDTVVVYGAGPIGLFAVLGAKAA
GASNIIVVDLFDSRLAKATEVGATHVFNAKEVNPVEEIRKLFPDGADVTIEAAGVESTFN
QAIQSTKVRGTMMVISFHTQDIQFNAPASLLFSGVKLLGSVGYSNETYNEVIQLLANGRL
PAQSIITSKVDIDNIAEQGFEALIHDKAQAKILVKLSGAH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcagtgtggtatggtgaaaaagatattcgtatcgaggaaagagaaacaaaa
gagttacaacccaatgatgtaaaagttaaagtggcatgggctggtatttgtggttctgat
ttacatgcatacttgcatccagattcagtaccaatgaataagaatatggtaatcggacat
gagttctctggtgaaattgcagaggttggttccctggtaacaaaatttaaagaaggggac
agagtatgtatttatccaatgatgcttaaagatccttcaaatgctgaaactgaacgtttt
atcactttagacgcagtaggtgcacaaatcgacggagggtttgctgaatacgtgatactt
ccacaaaaaacgatttttaaaattccagataatttatcactagaagtagcagcaatggta
gaaccagcagctgtatcattccaatcaattaaggattcaaatgtaggagaaggagatact
gttgttgtttatggcgccggccctattgggctatttgctgttttaggtgcaaaagctgca
ggtgcttctaatattattgttgttgatttatttgatagtcggcttgccaaagcaaccgaa
gtgggtgcgacgcatgtctttaatgctaaagaagtaaaccctgtagaagaaattcgtaaa
ttattcccagatggagcagatgtgacaattgaagctgcaggtgttgagtcaacatttaat
caagccattcaatcaactaaagttcgtggcacaatgatggttatcagcttccatactcaa
gatatccaatttaatgctcctgcttccttactctttagtggcgtaaaattattgggatct
gtggggtacagtaatgaaacttataatgaggtcattcaattactcgctaatggaagatta
cctgcacaatccattattacaagcaaagttgatatagataatattgctgaacaaggtttt
gaagcgttaattcatgataaagcgcaagcaaaaattttagttaaattaagtggcgcacat
taa

DBGET integrated database retrieval system