KEGG   Bacillus cereus AH187: BCAH187_A1614Help
Entry
BCAH187_A1614     CDS       T00799                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bcr  Bacillus cereus AH187
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BCAH187_A1614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Cnd3 TMEM238
Motif
Other DBs
NCBI-ProteinID: ACJ81348
UniProt: B7HKH6
Position
complement(1495819..1496817)
Genome map
AA seq 332 aa AA seqDB search
MDTLLILTVLVVICALAFDFINGFHDTANAIATAVSTKALKPRHAIIMAAIMNFLGAMTF
TGVAKTITKDIVDPFALQNGSLVILAALLAAIAWNLITWYYGIPSSSSHAIIGSIAGAAI
AAAGFSSLNFKGFIKIIEALIISPIIAFVIGYIVYSIFKVVFKNFNLTKTNKNFRIFQIF
TAALQAYTHGTNDAQKAMGIITMALMANSYHTSSDIPFWVQLSCAIAMGLGTSVGGWKII
KTVGGQIMKIRPVNGVAADLSSSLVIFGATFIHLPVSTTHVISSSILGVGASHRVKGVKW
GTAKRMLITWVITLPISASLAALFYSLLHLIF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatacactcttgatactgaccgttttagtagtcatttgcgctttagcttttgacttt
attaatggatttcacgatacagcaaacgctattgcaacggctgtttcaacgaaagctcta
aagcctagacatgcaattattatggcagctattatgaactttttaggtgcgatgacattt
acaggtgtagcaaaaacgattacgaaagatatcgttgatccgttcgctttacaaaatggt
tctcttgtaattttagccgctttacttgcggcaatagcatggaatttgattacttggtac
tacggtattccaagtagttcttcgcatgcaatcattggctccatcgcaggtgcagctatc
gctgctgctggttttagttcattaaactttaaaggattcataaaaattattgaagcttta
atcatttcaccaattatcgcatttgttattggttatatcgtatacagtatttttaaagtc
gtctttaaaaactttaatttaacgaagacgaacaaaaacttccgtatattccagattttc
actgctgcattacaagcttatacacatggtacgaatgatgcgcaaaaagcaatgggaatt
attacaatggctcttatggcgaatagttatcatacttctagcgacatcccgttctgggta
caattatcttgtgccattgcaatgggtcttggtacttctgtcggcggatggaaaattatt
aaaactgtcggtggacaaattatgaaaattcgtcctgtaaatggtgtagctgctgattta
tcatcatctcttgttattttcggggcaacattcattcacttaccagttagtacgacgcac
gttatctcctcttctattttaggggttggtgcttctcatcgtgtaaaaggtgtaaaatgg
ggaactgcaaaacgcatgttgattacttgggttattacacttcctatttcagcttcatta
gctgctttattttattctttattacacttaatcttttaa

DBGET integrated database retrieval system