KEGG   Bacillus cereus AH187: BCAH187_A2113Help
Entry
BCAH187_A2113     CDS       T00799                                 

Definition
(GenBank) endo-alpha-N-acetylgalactosaminidase
  KO
K17624  endo-alpha-N-acetylgalactosaminidase [EC:3.2.1.97]
Organism
bcr  Bacillus cereus AH187
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCAH187_A2113
Enzymes [BR:bcr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.97  endo-alpha-N-acetylgalactosaminidase
     BCAH187_A2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_101 GalBD_like Gal_mutarotas_3 Glyco_hyd_101C DUF4303 Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: ACJ81926
UniProt: B7HNF5
Position
complement(1977885..1981403)
Genome map
AA seq 1172 aa AA seqDB search
MKKSKRKFKRKIATLVTSCVVGSTCFTNGSLIQAEGTTDTKQTKQAENQIISQSPNAVIS
SNQMNVLVDVNFPRVIQYDLKSGNGAGKTFYGQTETLNTILINDVAVKPKVKTKVSSEKV
VYEMTVIDTPNNISAVITAELAVKENILEFNITKIVDNKIVKTIEIPNHNLISVNNSQKN
AVLDGVQMSTNTRINGDRQVKVDESLITKDEEQKGYMYAFLSTDELSASIWSNTENSLAK
KLTPDSYAAKTDAQRITATATTNSTGKKTLGLSSTFWTYQKSEGHRKEDGTLELKDGTVN
KVDEMPSVKVIITADANDDKKINWQDGAIAYRKIMNEPLGAEKVPDLVGYRVNMNFGSQA
QNPFLMALDGVKKFYLNTDGLGQSILLKGYGSEGHDSGHLNYADIGTRIGGAKDMKALLT
KGKEYGASFGVHVNASETYPESKYFQEDRLLKNPDGTYKYGWNWIDQGININADYDLRNG
RAQRFKDLYDVLGGKKNDLDFIYVDVWGNGQSGDNSTWPSRQLSKEINSLGWRLGSEWGY
ANEYDSTFQHWAADLTYGGYTLKGINSTITRFIKNHQKDAWIGNYPKYGGDADAPLLGGY
SMKDFEGWQGRSDYKAYIDNLFAVNIPTKFIQHYKVTQWENGKAVEMKDDKQQPYNWVPG
MKTVLKDESSENTLTIERKSNNFANDQDGYRTRTMTLNGKQIFEGKPGDEKYLFPWSWDQ
NGKKLSAENEKLYHWNTNGGKTTWTVPTGWQGTVKVYELTELGKEKMKNVKIENGKITLD
AKKSTPYVIYKGPKSNKDVKWSEGMHLIDTGFNSNSLKDWKIKGDSKAVKITKSEGNNNM
LTISNNKKKVHVTQKLTDLKPNTRYAAYVGIDNRSEAQASLTITSNDKEYTNSTGKSIAK
NYVRAYAHNTLGSEQAKADGQMTSTVDGTSYFQNMYVFFETGNRTSDVTIDLSRDSGNGA
SYFDDIRIVESNAENQVSDHKFVQDFENVVQGIYPFVIGNIEGVEDNRTHLSELHAPYTQ
RGWNQKIVNDVIAGKWSLKTNGLTEGDALVYQTIPQNFTFKPEVTYKITFDYEAGSDGTY
SVVTGNAPFEEKGVLTKEELKSTASSDKNTRAGTYSFTLTGDKSGQSWFGIYSTNKAANT
NGVKGSQANFNGYKDIMIDNLVIEVVPNKVKL
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcgaaaaggaaattcaagaggaagattgcaacacttgtaacaagttgtgtc
gtaggttctacttgttttacaaatggttccctaatccaagccgaaggaaccacggatact
aaacaaactaaacaagctgaaaatcaaatcatttctcaaagcccaaatgcggttatttca
tctaatcaaatgaatgttctcgttgatgtgaattttccaagagtcattcaatacgattta
aaatccggaaatggagcaggaaagactttttacggacagactgagacattaaatacaatc
cttataaatgatgtagcagtaaaaccaaaagtaaaaacaaaagtttcctcagagaaagtt
gtatatgagatgacggtaatagatactcccaacaatatctctgcggttattactgctgag
ttggctgttaaagagaatatattagaattcaatattacaaagatcgtcgacaacaaaatc
gtaaaaactatcgaaattccaaatcataatttaatttctgtaaataacagtcaaaaaaac
gcagtgctagatggcgtacagatgtcaacaaatacacgtattaatggtgatagacaggta
aaggttgatgaaagtttaattacgaaagatgaagagcaaaaaggatatatgtatgccttt
ctttctactgatgaattaagtgcaagtatatggtcgaatacagagaatagtttagcaaaa
aaattgactccagattcttatgctgcaaagaccgatgctcaaagaattacggcaactgct
acgactaatagtacaggaaaaaaaacacttggtctaagtagtaccttctggacgtatcaa
aagtcagaaggacatcgtaaagaagatggcactctagagctaaaggatggaacagttaat
aaggttgatgaaatgccgtccgtgaaagtaatcattactgctgacgctaatgatgataaa
aagataaactggcaagacggagcaattgcttatagaaaaattatgaacgaacctctaggg
gcagaaaaggttccagacttagttggttaccgtgttaatatgaactttggcagtcaagcc
caaaatcctttcttaatggctttagacggagtaaaaaagttttatttaaatactgatgga
ctaggacaatctattctactaaaaggttatggtagtgaaggacatgattctggtcattta
aattatgctgatattggaacccgaattggcggtgcaaaggacatgaaagcattgctaaca
aaggggaaagaatatggggcatcttttggtgttcatgtgaatgcaagtgaaacatatcca
gagtcaaaatatttccaagaagatcgtttattaaaaaatccagatggaacttataaatat
ggttggaactggattgaccaaggaataaacattaacgctgattatgatttaagaaatggt
agagcacaacgattcaaagatttatatgatgttcttggtggtaaaaaaaatgatttagat
tttatttatgtagatgtttggggtaatggacagtcaggtgataatagcacatggccgagc
cgtcaattaagtaaagaaataaacagtttaggttggcgcttaggtagtgagtggggatat
gcaaatgagtatgattctacattccaacactgggcagccgatttaacttatggcgggtat
acgctaaaaggcattaatagtacaatcacccgtttcattaaaaaccatcaaaaagatgca
tggattggtaactatcctaagtatggaggcgatgcagatgctccattattaggtggatac
agtatgaaagactttgaaggttggcaaggtaggagtgactacaaagcgtatattgataat
ttatttgcggtaaatattccaaccaaattcattcaacattataaagtcacacagtgggaa
aatggtaaagcagttgaaatgaaagatgataagcaacaaccttacaactgggtaccaggt
atgaagacagtattaaaggatgaatctagtgaaaatacacttacaattgaaagaaaatca
aataattttgcaaatgatcaagatggctatcgaacaagaactatgacattaaatggtaaa
caaatatttgaaggtaaacctggtgacgaaaaatatttatttccatggtcttgggatcaa
aatggtaaaaaattatcagcagagaatgaaaaattatatcactggaacacaaacggtgga
aaaacaacgtggactgtccctactggttggcaaggtaccgttaaagtgtatgagttaaca
gaattaggtaaagagaaaatgaaaaatgttaaaattgaaaatggaaaaatcacattagat
gcaaaaaaatctactccatatgtaatttataaagggccaaagtccaataaagatgttaaa
tggagtgaaggaatgcaccttatagatactggatttaatagcaattccctaaaagattgg
aaaattaaaggagactcaaaagctgttaagatcacgaagagtgaaggtaataataatatg
ctaacaatctccaataataaaaagaaagtacatgtaactcaaaaattaacagacctaaaa
cctaatacaaggtatgctgcatatgtgggtatagacaaccgaagtgaagcacaagcaagc
ttaacaattacttctaacgacaaagagtacacaaatagtactggtaaatctattgctaaa
aactatgtaagagcatacgcacataatacactaggctctgagcaagcaaaagctgatggt
caaatgacttcaactgtggatggaacaagttactttcaaaatatgtatgtgttttttgaa
actggcaatagaacatcagatgtaaccatcgatttatctagagatagtggaaatggcgca
agttactttgatgatattcgcatcgtggaaagtaatgccgaaaaccaagtaagcgatcat
aaattcgtacaagactttgaaaacgtagtacaaggcatctatccgtttgtaattggtaat
attgaaggcgtagaagataatagaacacacctgtctgaattacatgcaccatatacacaa
agaggttggaaccaaaaaatagtaaatgatgttatcgcaggtaaatggtcacttaaaacg
aatggattaacagaaggtgatgctcttgtgtatcaaacgatccctcaaaacttcacattt
aaaccagaagtaacctataaaattacttttgattatgaagcaggtagtgatggaacgtat
tcagtggtgacaggtaatgctccatttgaagaaaaaggagtattaacgaaggaggaatta
aaatcgaccgcaagtagtgataagaatacaagagctggcacatattcctttactttaaca
ggagataaatccgggcaaagctggtttggcatttattccactaataaagcagctaatact
aatggtgtgaaaggctcacaagctaactttaacggttataaagatattatgattgataat
ctagttattgaagtagtgccaaataaagtgaaactttaa

DBGET integrated database retrieval system