KEGG   Bacillus cereus AH187: BCAH187_A3217Help
Entry
BCAH187_A3217     CDS       T00799                                 

Definition
(GenBank) ribose transport system permease protein RbsC
  KO
K10440  ribose transport system permease protein
Organism
bcr  Bacillus cereus AH187
Pathway
bcr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCAH187_A3217
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcr02000]
    BCAH187_A3217
Transporters [BR:bcr02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    BCAH187_A3217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ACJ78892
UniProt: B7HWT8
Position
complement(2991125..2992129)
Genome map
AA seq 334 aa AA seqDB search
MEIQKVVELPVKGKMRKGMNTNALQQLLAFASLIVLVVIFSIASANFLQFDNIIGIFLST
AVTGILALGATMIIVTSGIDLSCGTVLTLSSVMTGVFAVNLGLPVWVAVLGGILIGAVVG
LISGAAIAKLKIPPFIATLAMMMIAKGLALVISKATPIYFTSIPSFNKIAMGSIIPGFAI
PNAVFIFFGMAIFASLILNKTIIGRYTFALGSNEEATRLSGVNVDKWKIIIYMLAGVFTG
VAGIIMASRLNSAQPALGAGYELEAIAAVVIGGTSLSGGKGTILGTVIGALIMSVLTNGL
QILSVPQEWQTVVVGAVILLAVYADVLRNKKAKN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaaatacaaaaggtagtcgaacttccagttaaagggaagatgaggaaagggatgaat
acaaatgctcttcagcagcttctagcatttgcaagtttaattgtacttgttgtcattttt
tcaattgcttcagctaattttctgcaatttgataatattataggcatctttttatcaaca
gctgttacaggcatccttgctttaggggcaacgatgattatcgttacaagtggaattgat
ttatcctgtggaaccgtactaaccttgtcttcggttatgacaggtgtgtttgctgtcaac
ttaggtttaccagtttgggtagctgtactcggaggtattttaataggtgccgtagtaggt
ttaatttctggagctgcaattgcaaaattgaagattccgccatttattgcaacgttagcg
atgatgatgatcgcgaaaggattggcacttgttatttcgaaagccactccaatttatttc
acttctataccaagctttaacaaaattgcgatgggttctattatccctggctttgctatt
ccgaatgctgttttcatcttttttggaatggctattttcgcaagcttaattttaaataaa
acgattatcggaaggtatacatttgcactaggaagcaatgaagaagcaactaggctttca
ggagtgaatgttgataagtggaaaatcattatctacatgcttgcaggtgtttttactggt
gttgcagggatcataatggcatctcgtctaaattctgcccagccagctttaggagcggga
tatgaattggaagcaatcgcagcagtcgttatcggaggaacttctttaagtggtggtaaa
ggaacaattcttggtactgttatcggtgcattgattatgagtgtgttaacaaatggtctt
caaatcctttccgtaccgcaagagtggcaaacagtagttgttggagcggttatcttattg
gcagtttacgcagatgtgttacgaaacaaaaaagcaaagaattaa

DBGET integrated database retrieval system