KEGG   Bacillus cereus AH187: BCAH187_A3528Help
Entry
BCAH187_A3528     CDS       T00799                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00010  Glycolysis / Gluconeogenesis
bcr00071  Fatty acid degradation
bcr00350  Tyrosine metabolism
bcr00625  Chloroalkane and chloroalkene degradation
bcr00626  Naphthalene degradation
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
bcr01120  Microbial metabolism in diverse environments
bcr01130  Biosynthesis of antibiotics
bcr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH187_A3528
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCAH187_A3528
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BCAH187_A3528
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCAH187_A3528
   00626 Naphthalene degradation
    BCAH187_A3528
Enzymes [BR:bcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCAH187_A3528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N AlaDh_PNT_C ELFV_dehydrog DUF1687 YjeF_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ACJ77875
UniProt: B7HZ81
Position
3276335..3277333
Genome map
AA seq 332 aa AA seqDB search
MKAMIIDKYGKVPMRMAEVPIPEINEHEVLAEIHAASINPIDFKIRDGKVKMLLKYEMPL
ILGNDFAGVIIKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEE
AASIPLVGLTSYQALHDIMQLQKNQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGA
NLVKSLGADQIINYKTEKFEEILKDYDAVFDTIGGTTLEKSFDIIKSGGSIVSVSGMPNA
RFGKEFGSGFFKTFLFSLASKKLTALEKKHNAQYSFLFMKPSGDQLRTIANYIEAGKIKP
VIDRVFPFEDAQKAMEYSEAGRAKGKIIVKMK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgataattgataagtacggaaaagtcccaatgcgtatggccgaggtacct
attcctgaaataaatgagcatgaagtgctcgcagaaattcatgcagctagtattaaccca
attgattttaaaatacgcgatggaaaagtaaagatgttacttaaatatgaaatgccccta
atccttgggaatgactttgctggtgtcatcataaaggttggatcaaaagtaactcgtttt
aaagtcggcgatgaaatatatgcacgtccaagaaaaaataagattggtacttttgcggag
tatatagccattcatgaagatgacatagctttaaagccgaaaaatttaagttttgaagaa
gctgcttcaattccacttgttggcttaacatcataccaagcattacatgacattatgcaa
ttacaaaaaaatcaaaagattttaattcacgctggatctggtggtgttggtactttcgca
attcagttagcaaaaataatgggtgctaccgttacaacaactgctagtgaggctggtgca
aatttagtaaagtctcttggcgcagatcaaattattaattataaaacagaaaaatttgaa
gaaatactaaaagattatgatgcagtatttgataccattggtggtacaacacttgaaaaa
tcattcgatattataaaaagcggcggcagcattgtttctgtttcaggaatgccaaatgct
cgtttcggtaaagaattcggttctggattttttaaaacattcttattttcattagcaagt
aaaaaacttactgcacttgaaaaaaagcataatgctcaatattcatttttatttatgaag
ccaagcggagatcaattacgtactatcgcaaactatattgaagccggaaaaatcaaacct
gtaatcgatcgagttttcccttttgaagatgctcaaaaagcaatggaatattcagaggct
ggaagagcaaaggggaaaataattgtaaaaatgaaataa

DBGET integrated database retrieval system