KEGG   Bacillus cereus AH187: BCAH187_A4150Help
Entry
BCAH187_A4150     CDS       T00799                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00071  Fatty acid degradation
bcr00072  Synthesis and degradation of ketone bodies
bcr00280  Valine, leucine and isoleucine degradation
bcr00310  Lysine degradation
bcr00362  Benzoate degradation
bcr00380  Tryptophan metabolism
bcr00620  Pyruvate metabolism
bcr00630  Glyoxylate and dicarboxylate metabolism
bcr00640  Propanoate metabolism
bcr00650  Butanoate metabolism
bcr00900  Terpenoid backbone biosynthesis
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
bcr01120  Microbial metabolism in diverse environments
bcr01130  Biosynthesis of antibiotics
bcr01200  Carbon metabolism
bcr01212  Fatty acid metabolism
bcr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAH187_A4150
   00630 Glyoxylate and dicarboxylate metabolism
    BCAH187_A4150
   00640 Propanoate metabolism
    BCAH187_A4150
   00650 Butanoate metabolism
    BCAH187_A4150
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCAH187_A4150
   00072 Synthesis and degradation of ketone bodies
    BCAH187_A4150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCAH187_A4150
   00310 Lysine degradation
    BCAH187_A4150
   00380 Tryptophan metabolism
    BCAH187_A4150
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCAH187_A4150
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCAH187_A4150
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCAH187_A4150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcr04147]
    BCAH187_A4150
Enzymes [BR:bcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCAH187_A4150
Exosome [BR:bcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCAH187_A4150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACJ81144
UniProt: B7HN00
Position
complement(3871986..3873161)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPTIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagcggcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagttgatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcaagaacggctgcattagcggcaggatttcctgacacagttaca
ggttatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgtcgttgcaggtggagtagaagcaatgagttca
agcccttatgcattaaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtattagaagatccaattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgt
agtcatacattggcattgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcaaaggatgaacatccacgtgct
gacattacagcagaaaaattagcaggattaaaaccagctttccgtaaagacggatctgta
acggcagggaatgcatctggcctgaatgacggaagtgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaacaattatgggtattggaccagcaccagcaattcgtaaagggttagaa
aaagtagattggtcattagaagatgcagatttgctggaaattaacgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaggtgaatgtaaacggt
agtggtgtaggacttggacatccaatcggttgtacaggagctcgtatcactgtaagctta
attcatgaattgaaaagacgcggattagaaaaaggaattgcctctctatgcgtcggcggc
ggtattggggtagcattatttatagaagcactataa

DBGET integrated database retrieval system