KEGG   Bacillus cereus AH187: BCAH187_A4245Help
Entry
BCAH187_A4245     CDS       T00799                                 

Gene name
ribBA
Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00740  Riboflavin metabolism
bcr00790  Folate biosynthesis
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
Module
bcr_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BCAH187_A4245 (ribBA)
   00790 Folate biosynthesis
    BCAH187_A4245 (ribBA)
Enzymes [BR:bcr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BCAH187_A4245 (ribBA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     BCAH187_A4245 (ribBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ACJ82500
UniProt: B7HNM8
Position
3949517..3950710
Genome map
AA seq 397 aa AA seqDB search
MFHRIEEALEDLKQGKVVIVCDDENRENEGDFIALAEYITPETINFMITHGRGLVCVPIT
EGYAERLQLEPMVAHNTDSHHTAFTVSIDHVSTTTGISAHERATTIREMLNPASKGADFN
RPGHIFPLIAKEGGVLRRAGHTEAAVDLAQLCGAEPAGVICEIINEDGTMARVPDLLQCA
KQFDIKMITIEDLIAYRRHHETLVTREVEITLPTDFGTFHAIGYSNSLDSKEHIALVKGD
ISTGDPVLVRVHSECLTGDVFGSCRCDCGPQLHAALAQIEREGKGVLLYMRQEGRGIGLL
NKLRAYKLQEEGFDTVEANEKLGFPADLRDYGIGAQILKDLGLQHLRLLTNNPRKIAGLQ
GYDLEVIERVPLQMPAKEENKTYLQTKVNKLGHLLNL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatcgtattgaagaagctctagaagatttaaaacaaggaaaagtcgtgatcgta
tgtgatgatgaaaaccgtgaaaatgaaggcgattttatcgctttagcagagtatattacg
ccagaaacaattaactttatgattacacatggacgtggtctcgtttgtgtaccaattaca
gaagggtacgcagaacgtctacaattagaaccaatggtagctcataatacagattcgcat
catactgcatttacagtgagcattgatcatgtttctacaacaactgggattagtgcccac
gaacgtgcaactacgatacgagaaatgttaaatcctgcatcaaaaggtgctgatttcaat
cgtcccggacatatctttccattaattgcgaaagaaggtggtgtcttgcgccgggctggt
catacagaagctgctgtcgatttagcacagctctgcggagcagaaccagctggcgtcatt
tgtgaaattattaatgaggacggtacgatggcacgggtacctgatttactacagtgcgca
aaacaatttgatataaaaatgattacaatagaagatttaattgcttatcgccgccaccat
gaaacattagtgacgcgagaagtggaaattacattacctacagatttcggtactttccat
gcaattggctattctaattccttagattcgaaagagcatatcgcactcgtaaaaggtgat
atttcaacaggagatcctgtacttgtacgcgttcattcagagtgcttaacaggagatgta
tttggctcgtgccgatgtgattgcggaccacaactccatgctgcacttgctcaaattgag
cgtgaaggaaagggcgttcttctttatatgagacaagaaggacgaggcattgggcttctg
aataagcttcgcgcttataagttacaagaagaaggattcgatactgtagaagcaaatgaa
aagcttggcttccctgctgatttgcgggattatggtattggcgctcaaatattaaaagat
ttaggtttacaacatttacgattattaacgaataacccaagaaaaattgctggcttacaa
ggttacgatttagaagtaatcgagcgtgtaccgttacaaatgccagcaaaagaagagaat
aaaacgtatttacaaacgaaagtaaacaaattaggacatttactaaacttataa

DBGET integrated database retrieval system