KEGG   Bacillus cereus AH187: BCAH187_A4396Help
Entry
BCAH187_A4396     CDS       T00799                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00010  Glycolysis / Gluconeogenesis
bcr00052  Galactose metabolism
bcr00500  Starch and sucrose metabolism
bcr00520  Amino sugar and nucleotide sugar metabolism
bcr00521  Streptomycin biosynthesis
bcr01100  Metabolic pathways
bcr01110  Biosynthesis of secondary metabolites
bcr01120  Microbial metabolism in diverse environments
bcr01130  Biosynthesis of antibiotics
bcr01200  Carbon metabolism
Module
bcr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCAH187_A4396 (glcK)
   00052 Galactose metabolism
    BCAH187_A4396 (glcK)
   00500 Starch and sucrose metabolism
    BCAH187_A4396 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BCAH187_A4396 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BCAH187_A4396 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BCAH187_A4396 (glcK)
Enzymes [BR:bcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BCAH187_A4396 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: ACJ79819
UniProt: B7HPG3
Position
complement(4073283..4074266)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETDKESILRSMLAEEGRITSKDVFEAHGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtatacggtgaaattttacataagtgggaaatccctacgaatacaaatgagcaa
ggaaaacatattacacttgatgtagcgaaagctattgataaaaagttagaagagttaggc
gaattaaaaagtaagttaatcggtattggtatgggagctcctggccctgtacacgtggcg
tctggaatgatttatgaagcggttaacttaggatggaagaactatccgttaaaagattta
ttagaagtagaaacaggattacctgttgtgattgataatgatgcgaacttagcagcgctt
ggtgaaatgtggaaaggtgctggtgaaggagcaaaagatttaatttgtatgacgcttggc
actggtgttggcggcggtgtaattgccaatggagagattgtacacggcgtaagcggtgct
gctggtgaaatcggacacattacagtcgttacagagaatgctttcccatgtaattgcggg
aagtctggttgcctagaaactgtagcatctgcaacaggtattgtgcgtgttgctatgcaa
aaaatacaagagactgataaagaaagtattttacgttctatgttagcagaagaaggacgt
atcacatcaaaagacgtatttgaagcacatggacaaggtgatgaactagcaggcgaagta
gtagaaaaggtagcttcttatttaggattagctgtagcgaacctttctagcacgttgaac
ccagagaaaatcgttattggcggaggcgtttctaaagctggagatgcacttttagaacca
attcaacgctattttgagcaatatgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system