KEGG   Bacillus cereus AH187: BCAH187_A4623Help
Entry
BCAH187_A4623     CDS       T00799                                 

Gene name
racE2
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00471  D-Glutamine and D-glutamate metabolism
bcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BCAH187_A4623 (racE2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcr01011]
    BCAH187_A4623 (racE2)
Enzymes [BR:bcr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BCAH187_A4623 (racE2)
Peptidoglycan biosynthesis and degradation proteins [BR:bcr01011]
 Precursor biosynthesis
  Racemase
   BCAH187_A4623 (racE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Flu_M1
Motif
Other DBs
NCBI-ProteinID: ACJ82470
UniProt: B7HQP6
Position
complement(4284473..4285282)
Genome map
AA seq 269 aa AA seqDB search
MKLNRAIGVIDSGVGGLTVAKELIRQLPKERIIYLGDTARCPYGPRSREEVRQFTWEMTE
HLLDLNIKMLVIACNTATAVVLEEMQKQLPIPVVGVIHPGSRTALKMTNTYHVGIIGTIG
TVKSGAYEEALKSINNRVMVESLACPPFVELVESGNFESEMAYEVVRETLQPLKNTDIDT
LILGCTHYPILGPVIKQVMGDKVQLISSGDETAREVSTILYHSKMLNEGEEQSDHLFLTT
GKIGLFKEIASKWFGQPIENVKHIYLEKE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaatagagcaatcggtgttatcgattcaggagttggcggtttaacagtggcg
aaggaattaattcgtcagttgccgaaagagcgcattatatatttaggggatacagcacgt
tgcccttatggtccacgttctcgagaagaagtgcgtcaatttacgtgggaaatgacggag
catttactagatttaaatatcaaaatgttagttattgcatgtaatacagcaactgcagtt
gtattagaagagatgcagaaacaattaccaattccagtggtaggagttattcacccagga
tcacgtacagctttaaaaatgacaaacacgtatcatgttgggattattggaacgattgga
acggtgaaaagtggtgcatacgaagaagcgttaaagtctattaataatcgtgttatggta
gaaagtttagcgtgtccaccttttgttgagcttgtagagagcggtaatttcgaaagtgaa
atggcgtatgaagttgtaagagaaacgttgcaaccgctgaaaaacactgatattgatacg
cttattttaggctgtacacattatccaattttaggtcctgttattaaacaagtaatggga
gataaagtgcaactcattagttctggtgatgaaacggcacgtgaagtaagtaccatttta
taccatagtaaaatgttgaatgagggagaggaacaaagtgatcatctcttcttaacaaca
ggaaaaataggcctatttaaagaaattgcatcaaaatggttcggtcaaccgattgaaaat
gtgaaacatatttatttagaaaaagaataa

DBGET integrated database retrieval system