KEGG   Bacillus cereus AH187: BCAH187_A4729Help
Entry
BCAH187_A4729     CDS       T00799                                 

Definition
(GenBank) putative malate dehydrogenase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00620  Pyruvate metabolism
bcr01200  Carbon metabolism
bcr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCAH187_A4729
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCAH187_A4729
Enzymes [BR:bcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     BCAH187_A4729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog Shikimate_DH ThiF
Motif
Other DBs
NCBI-ProteinID: ACJ81274
UniProt: B7HRP3
Position
complement(4389548..4390786)
Genome map
AA seq 412 aa AA seqDB search
MSTLREEALHMHKVHQGKLETVSKVKVENAKDLSLAYSPGVAEPCKEIYDDKSKVYEYTM
KGNMVAVVTDGTAVLGLGNIGPEASLPVMEGKAVLFKSFAGVDAFPIALNTNDVDKIVET
VKLMEPTFGGVNLEDIAAPNCFIIEERLKKETNIPIFHDDQHGTAIVTVAGLVNALKLVG
KKMSDIKVVANGAGAAGIAIIKLLYRYGVRDIIMCDRKGAIYEGRPTGMNPVKDEVAKYT
NKNRIEGSLADVVQGADVFIGVSAEGALTEEMVRTMNDDAIIFAMANPVPEIMPELAKAA
GAAVVGTGRSDFANQVNNVLAFPGIFRGALDVHATQINEEMKMAAVQAIAELVAEDELNA
DYIIPAPFDARVAPQVAAYVAKAAMETGVARRQVDPNEVAEKTKQLALIGKE
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaacacttcgtgaagaagcacttcacatgcataaagtgcatcaaggaaaattagaa
actgtatcaaaagtaaaagtagaaaatgcaaaagatttaagtcttgcatattctccaggg
gttgcagaaccttgtaaagaaatttatgacgataaaagtaaggtatatgaatatacgatg
aagggaaatatggtagcagttgtgactgatggaacggctgtacttggtcttggtaacatc
ggacctgaagcatctcttccagtaatggaaggtaaagctgtattattcaagagctttgct
ggtgtagatgcattcccaattgccttaaatacaaacgatgtagataaaattgttgaaact
gtaaaattaatggagccaacttttggcggcgttaacttagaggatatcgcagcaccaaac
tgcttcattattgaagaacgtttgaaaaaagaaacaaatattcctatcttccatgatgat
caacacggaacagctatcgtaacagtagcgggtcttgtgaacgcgctaaaactagttgga
aagaaaatgtctgacattaaagttgtcgcaaatggcgcaggtgcagcaggtattgcaatt
attaagcttttatatcgctatggcgtacgcgacattattatgtgtgaccgtaaaggggca
atctatgaaggtcgtcctacaggtatgaatccggtgaaggatgaagttgcaaaatataca
aataagaatcgtatcgaaggttctttagctgatgttgtacaaggtgcggacgtattcatt
ggtgtatctgcagaaggtgcattaacagaagaaatggttcgtacaatgaatgacgatgca
attatttttgcaatggcgaatccagttccagaaattatgccagaattggcaaaagcagcg
ggcgcagctgttgttggaacgggtcgttctgacttcgcaaaccaagtaaataatgtacta
gcgttccctggtattttccgcggtgcacttgacgtacatgcgacacaaattaatgaagaa
atgaagatggcagctgtacaggctattgctgagcttgtagcagaagatgagttaaatgca
gactatatcattccagcaccgtttgatgcgcgtgtagcgcctcaagtggcagcttacgtt
gcgaaagctgcaatggagacaggagtagctcgccgtcaagtagatccaaatgaagttgct
gagaaaacaaaacaattagcgctgattggtaaagaataa

DBGET integrated database retrieval system