KEGG   Bacillus cereus AH187: BCAH187_A5192Help
Entry
BCAH187_A5192     CDS       T00799                                 

Definition
(GenBank) putative methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bcr  Bacillus cereus AH187
Pathway
bcr00450  Selenocompound metabolism
bcr00970  Aminoacyl-tRNA biosynthesis
bcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BCAH187_A5192
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCAH187_A5192
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcr01007]
    BCAH187_A5192
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcr03016]
    BCAH187_A5192
Enzymes [BR:bcr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BCAH187_A5192
Amino acid related enzymes [BR:bcr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BCAH187_A5192
Transfer RNA biogenesis [BR:bcr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BCAH187_A5192
 Prokaryotic type
   Other AARSs
    BCAH187_A5192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Laminin_EGF
Motif
Other DBs
NCBI-ProteinID: ACJ78819
UniProt: B7HVW2
Position
complement(4784205..4785839)
Genome map
AA seq 544 aa AA seqDB search
MSIFIGGAWPYANGSLHLGHIASLLPGDILARYYRAKGENVLYVSGSDCNGTPIAIRAKQ
EGVTAKDIADQYHEEFERCFRSLGFTYDCYTRTDSEHHHETVQNVFLRLLEEGHIYKKTV
EQAYCETCTQFLPDRYVEGICPHCHEAARGDQCDACSAILDPLDLLEKKCKLCGSTPSVQ
ETEHFYFALHTFQEQIKTAVENVKQTGTWRDNAIQLTERYVKEGLQDRAVSRDLPIGVPI
PVEGYEDKKIYVWIEAVTGYYSASKHWAEKTGEDDQEFWDSEAKTYYVHGKDNIPFHSVI
WPAVLLGIGEGAIPRHIVSNEYLTVEKRKLSTSKNWAVWVPDILERYDPDSIRYFLTVNA
PENRDTDFSWREFLYSHNSELLGAYGNFVNRTLKFIEKYYGGIVPKGSIDVELKDKVEGL
YKHVGEAIEQTKFKVALESIFDAVRFANKYFDEKQPWKQREDNPVSCEETIYNCVYLIAN
FVNLLEPFLPFSSERIRNTLSIVNRNWEPQHTLPSRIDSVQPLFERIDVKQIEHEVEKLY
GAVK
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttttattgggggcgcttggccgtatgcaaatggttcgttacatcttggacat
attgcgagtttgttacctggtgatattttagcacgttattaccgggcaaaaggtgagaat
gtgttgtatgtttcgggaagtgattgtaatggaacaccaattgcaattcgggcaaaacaa
gaaggtgtgacggcgaaggacattgctgatcagtatcatgaagagtttgagcgatgtttt
cgtagccttggttttacgtatgattgctatacacgtacagatagtgagcaccatcatgaa
acggttcaaaatgtttttttacgtttattagaagagggacatatttataaaaaaacagtg
gaacaagcatattgcgaaacgtgtacacaatttttacctgatcgttatgtagaagggata
tgtccgcattgccatgaagcagcaagaggagatcaatgcgatgcgtgttcagctatttta
gatccactcgatttgttagaaaagaaatgtaagttatgtggtagtacaccatccgtacag
gaaacagagcatttctattttgcattgcatacatttcaggagcaaatcaaaacggctgta
gaaaacgtcaaacaaacaggaacatggcgcgacaatgcgattcagctaacagaaagatat
gtaaaggaagggttacaagatagggcggtttcacgagatttaccaatcggggtaccaatt
ccagtagaagggtatgaagataagaaaatttacgtgtggattgaagcagtgacaggctat
tattcagcgagtaaacattgggctgaaaaaacaggggaagatgatcaagagttttgggat
agcgaagcgaaaacatattatgtacacggaaaggataatattccgtttcattccgtcatt
tggccagcggtattgcttggaataggagaaggggcaattcctcgtcatatcgtttcaaat
gaatatttaacagtggaaaaaagaaaattatctacaagtaaaaactgggcggtatgggtg
cctgacatattagaacgctatgatccagattctattcgttactttttaaccgtcaacgca
ccagaaaatcgtgacactgacttttcatggcgggaatttctttacagtcataatagtgaa
ttgttaggggcatacggaaactttgtaaaccggacattaaaatttattgaaaagtattat
ggtggtatcgtgccgaagggaagtattgatgtagagctgaaagataaagtagaaggatta
tataaacatgtaggagaggcgattgagcaaactaaatttaaggtagcgctagaatcaata
tttgatgcagtacgttttgcaaataaatactttgatgagaagcagccttggaaacaaagg
gaggataatccagtttcatgcgaagaaacgatttataattgtgtgtatctcatcgctaat
tttgtaaatcttcttgaaccgtttttaccattttcaagtgaaagaattagaaacacatta
tcgattgtgaaccgaaattgggagcctcaacatacgttgccaagtagaattgatagcgtg
cagccactatttgaacggattgatgtgaaacaaattgagcatgaggtagagaaattatat
ggagcggtaaagtga

DBGET integrated database retrieval system